apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Farmer with a Pitchfork
Farmer with a Pitchfork by Winslow Homer

plate no. 2792

Farmer with a Pitchfork

Winslow Homer

oil, boardRealismgenre paintingfigurefieldhaystacksfarmerlandscapepitchfork

recreation guide

Winslow Homer’s *Farmer with a Pitchfork* is a genre painting executed in oil on board, reflecting the Realist tradition. As a genre work, it likely depicts a figure of everyday life without specific historical identity, focusing on the 'quotidian' aspects of rural labor (Source 8). The medium of oil painting allows for 'richer and denser color' and the use of layers, which are essential for achieving the realistic texture and depth characteristic of Homer’s work (Source 1). The painting relies on the plasticity of oil paint to mold textures, particularly for the rough clothing and the wooden pitchfork, leveraging the medium’s flexibility and wide range from light to dark (Source 1).

estimated time

20-30 hours over 5-7 sessions

materials

7 items

steps

6 in sequence

materials

itempurposemodern equivalent
Wood panel or boardSupport surface, consistent with the artwork's medium descriptionMDF or plywood panel, sealed
Linseed oilPrimary drying oil binder for pigmentsRefined linseed oil
TurpentineThinner for initial layers and cleaning brushesOdorless mineral spirits or turpentine
Raw UmberFor underpainting and setting the palette, as advised for painting from lifeRaw Umber pigment
White pigment (soft white)For mixing tints and highlightsTitanium White or Lead White (historical)
CharcoalFor initial drawing and shading before paint applicationVine charcoal
BreadFor correcting charcoal errors without damaging the surfaceKneaded eraser or bread

preparation

surface prep

Prepare a wood panel or board, as the artwork is specified as 'oil, board'. Ensure the surface is sealed to prevent oil absorption. While specific priming methods for this exact work are not detailed in the sources, traditional oil painting on wood often involves a gesso or oil ground to create a stable surface for the 'layers' of paint (Source 1).

underdrawing

Begin with a charcoal drawing. As advised for painting from life, draw and shade in charcoal, using a dry brush to model forms if necessary. Place the drawing alongside the reference (or model) to compare proportions, ensuring the study is slightly smaller than life if copying a specific reference. Make all corrections in the charcoal stage using bread to erase, as charcoal offers little resistance to correction, whereas correcting in paint is 'fatal to lucidity' (Source 4).

underpainting

Set the palette with raw umber and a soft white, using turpentine to thin the paint. Apply an initial underpainting to establish the basic tones and composition. This step is crucial for building the 'layers' that oil painting allows (Source 1). The underpainting should be done with the idea of going over it at least three or four times, allowing for gradual refinement (Source 4).

color palette

Raw Umber

Raw Umber pigment

Underpainting and establishing dark masses

White

Soft white pigment

Highlights and mixing tints

Earth Tones

Umbers, ochres, siennas

General use in this artist's palette for realistic depiction of rural subjects

Complementary Colors

Pairs such as red-green or blue-orange

Creating contrast and harmony in the composition, leveraging simultaneous contrast

composition

As a genre painting, the composition likely focuses on a single figure or a small group engaged in everyday labor, without specific historical identity (Source 8). The arrangement should emphasize the 'reality effect' of the scene, capturing a snapshot of quotidian life. While specific compositional details of this painting are not described in the sources, Homer’s Realist style suggests a straightforward, unidealized presentation of the subject.

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

  1. step 01

    Draw the figure and pitchfork in charcoal, shading to establish form. Compare with reference to ensure accurate proportions.

    Tip — Correct errors with bread before applying paint.

    Charcoal drawing

underpainting

  1. step 02

    Mix raw umber and white with turpentine. Apply a thin layer to establish the basic light and shadow structure.

    Tip — Plan for multiple layers; do not finalize details in this stage.

    Underpainting

first pass

  1. step 03

    Begin building up color layers, focusing on broad masses. Use the plasticity of the oil paint to mold textures.

    Tip — Utilize the 'wider range from light to dark' offered by oil paint.

    Layering

refining

  1. step 04

    Refine details, paying attention to the interaction of colors. Consider simultaneous contrast, where adjacent colors affect each other's appearance.

    Tip — Be aware that the eye may perceive colors differently due to adjacent hues.

    Simultaneous contrast

finishing

  1. step 05

    Add final highlights and shadows. Ensure the texture of the paint matches the subject matter (e.g., rough cloth, smooth wood).

    Tip — Use the paint's plasticity to create varied textures.

    Texturing

varnishing

  1. step 06

    Apply a varnish made from oil boiled with resin (e.g., pine resin or frankincense) for protection and texture.

    Tip — Ensure the painting is fully dry before varnishing.

    Varnishing

critical techniques

Layering

Oil painting allows for the use of layers, which is essential for building depth and richness in color. This technique is central to the medium's advantages.

Simultaneous Contrast

Understanding how adjacent colors affect each other's perception is crucial for accurate color mixing and harmony. The painter must account for the complementary color influence.

Charcoal Correction

Using charcoal for the initial drawing and correcting errors with bread before applying paint ensures a solid foundation and avoids 'fatal' corrections in paint.

common pitfalls

  • →Putting down paint with obvious errors in construction or drawing, which is 'reckless' and leads to difficult corrections.
  • →Ignoring the effects of simultaneous contrast, leading to inaccurate color perception and mixing.
  • →Attempting to finalize details in the underpainting stage, rather than planning for multiple layers.

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific visual details of the painting (e.g., exact clothing patterns, facial expression, background elements) are not described in the sources.
  • ·Winslow Homer's specific palette preferences for this particular work are not detailed; general Realist practices are inferred.
  • ·The exact year of creation is not available, limiting precise contextual analysis of his technique at that specific time.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • PAINTING FROM LIFE — applied to Underdrawing, underpainting, and correction techniques
  • Laws of Contrast of Colour↗

    • 315. As to the advantages the painter will find in it — applied to Simultaneous contrast and color perception

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Oil painting↗

    • Oil painting — part 1 — applied to Medium advantages, layering, varnishing, and texture
  • Wikipedia: Dutch Golden Age painting↗

    • Dutch Golden Age painting — part 11 — applied to Genre painting characteristics and subject matter

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

Portrait of James Wright

Portrait of James Wright

Thomas Eakins

Portrait of a lady

Portrait of a lady

Karl Gussow

Sisters

Sisters

Émile Auguste Hublin

Catching Up on the News

Catching Up on the News

Eastman Johnson

At the porter's room

At the porter's room

Vladimir Makovsky

Flowers and Fruit

Flowers and Fruit

Henri Fantin-Latour

Valle de México desde el Molino del Rey

Valle de México desde el Molino del Rey

Jose Maria Velasco

Self-Portrait II

Self-Portrait II

Mihaly Munkacsy