plate no. 9736

Mount Aragats

Martiros Sarian, 1925

oilExpressionismlandscapemountainsfieldsanimalsskytreeslandscape

recreation guide

Martiros Sarian’s 'Mount Aragats' (1925) is a seminal work of Armenian Expressionist landscape painting. Sarian, recognized as the founder of a modern Armenian national school of painting, drew heavily on his travels to Armenia and the Middle East for inspiration (Source 4). The work reflects his deep admiration for nature, influenced by his childhood in rural settlements (Source 4). As an Expressionist landscape, it likely prioritizes emotional resonance and color intensity over strict topographical accuracy, aligning with the broader tradition where landscape views may be 'entirely imaginary, or copied from reality with varying degrees of accuracy' (Source 1). The painting serves as a nationalist statement, consistent with the early 20th-century tendency to express the special nature of the homeland’s landscape (Source 7).

estimated time

20-30 hours over 5-7 sessions

materials

7 items

steps

6 in sequence

materials

item	purpose	modern equivalent
Oil paints (artist grade)	Primary medium for the painting	—
Linseed oil	To mix with paint for thinning and adhering; essential for 'fat over lean' layering	—
Mineral spirits or turpentine	Solvent for thinning initial layers and cleaning brushes	—
Canvas	Support surface	—
Charcoal or thinned paint	For initial sketching of the composition	—
Paintbrushes and/or palette knives	Application of paint; knives allow for scraping and textural application	—
Rags	For wiping away wet paint or adjusting texture	—

preparation

surface prep

Prepare a standard oil-primed canvas. While specific priming methods for Sarian are not detailed in the sources, traditional oil painting techniques assume a prepared surface to accept the oil medium (Source 2).

underdrawing

Begin by sketching the subject onto the canvas using charcoal or thinned paint (Source 2). Sarian’s work was inspired by his travels, so the drawing should capture the essence of the Armenian landscape rather than a rigid topographical map, as landscape views in art can be imaginary or loosely based on reality (Source 1).

underpainting

Apply an initial layer of thinned paint (lean layer) to establish the basic forms and values. This aligns with traditional oil painting techniques where the artist sketches and begins with thinner applications (Source 2).

color palette

Vibrant Earth Tones

Ochres, Umbers, Siennas

General use in Sarian’s palette, reflecting his inspiration from Armenian landscapes and nature (Source 4)

Intense Blues and Greens

Ultramarine, Phthalo Blue, Viridian

Sky and vegetation, consistent with Expressionist emphasis on color emotion rather than strict realism (Source 1, Source 4)

Warm Highlights

Cadmium Yellow, Orange

Capturing the light and spiritual element often associated with landscape art (Source 1)

composition

The composition should arrange natural scenery elements (mountains, sky) into a coherent whole (Source 1). Sarian’s landscapes often served as nationalist statements, so the scale and grandeur of Mount Aragats should be emphasized to reflect the 'special nature of the landscape of the homeland' (Source 7). The sky is almost always included in landscape views and should be a significant compositional element (Source 1).

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

step 01
Sketch the outline of Mount Aragats and the surrounding landscape using charcoal or thinned paint.
Tip — Keep lines loose to allow for expressive changes later.
Traditional oil painting sketching

underpainting

step 02
Apply a thin, lean layer of paint to block in major color areas and values.
Tip — Ensure this layer has less oil than subsequent layers to prevent cracking.
Lean underpainting

first pass

step 03
Build up the mountain forms with thicker paint, using brushes or palette knives.
Tip — Each additional layer should contain more oil than the layer below.
Fat over lean

refining

step 04
Adjust colors and textures to enhance the expressive quality of the landscape.
Tip — Use palette knives to scrape or add texture if needed, as oil paint remains wet long enough for adjustments.
Expressive brushwork

finishing

step 05
Finalize details and ensure the composition conveys the spiritual or emotional weight of the landscape.
Tip — Focus on the coherence of the composition and the impact of color contrasts.
Expressionist finish

varnishing

step 06
Allow the painting to dry completely (up to two weeks) before applying varnish if desired.
Tip — Oil paint dries by oxidation, not evaporation.
Oil drying process

critical techniques

Fat over Lean

A basic rule of oil paint application where each additional layer contains more oil than the previous one to ensure proper drying and prevent cracking.

Expressive Color Use

Sarian’s Expressionist style likely involves using color to convey emotion and national identity rather than strict realism, consistent with the Romantic and Expressionist traditions of landscape painting.

Palette Knife Application

Using palette knives to apply or scrape paint, allowing for varied texture and the ability to change form while the paint is wet.

common pitfalls

→Applying lean layers over fat layers, which can cause the painting to crack and peel (Source 2).
→Overworking the paint before it dries, leading to muddy colors; remember oil paint remains wet longer than other materials, allowing for changes but requiring patience (Source 2).
→Ignoring the 'fat over lean' rule, which is critical for the stability of the paint film (Source 2).
→Focusing too much on topographical accuracy rather than the expressive or spiritual element of the landscape, which is central to Sarian’s style and the broader landscape tradition (Source 1, Source 4).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

·Specific color palette used by Sarian for 'Mount Aragats' is not detailed in the sources; general Expressionist and Armenian landscape conventions are inferred.
·Exact brushwork or texture techniques specific to this painting are not described; general oil painting techniques are applied.
·Sarian’s specific preparatory sketches or underpainting methods for this work are not documented in the provided sources.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

Wikipedia: Oil painting↗
- part 2 — applied to Underdrawing, underpainting, fat over lean rule, palette knife use, drying time
Wikipedia: Landscape painting↗
- part 1 — applied to Composition, inclusion of sky, imaginary vs. real views, spiritual element
- part 7 — applied to Nationalist statement in landscape painting
Wikipedia bio — Martiros Sarian↗
- part 1 — applied to Artist’s inspiration, national school of painting, admiration for nature