plate no. 9736

Mount Aragats

Martiros Sarian, 1925

oilExpressionismlandscapemountainsfieldsanimalsskytreeslandscape

what to study here

It shows how four flat value zones, sharp edges and a cool-warm split can organize a landscape without atmospheric gradation.

The useful lesson here is how far a landscape can be simplified into flat zones of value. The vision analysis reads four bands: a mid-dark violet-brown mountain (around value 4-5), a lighter sky with cream clouds (6-7), bright yellow fields (7-8), and near-black cattle and figures (1-2). Squint and the mountain becomes one dark mass, the fields one bright mass, and the animals a small sharp accent. Value barely shifts inside each zone, so the structure comes from the steps between zones, not from modeling.

Study the edges. Field divisions are crisp teal-green lines, and edges stay sharp throughout, with only slight softening near snow and clouds. Lighting is frontal and nearly shadowless, so form comes from color temperature: cool purple mountain against warm yellow ground. Brushwork is flat and direct, with little visible stroke direction.

Try a value study of the four zones first, then test how small and dark the foreground figures can be while still pulling the eye down from the mountain.

key decision

Sarian kept each zone nearly flat in value and set the near-black foreground cattle against bright yellow fields. Crisp teal-green field lines hold the geometry together.

recreation guide

Martiros Sarian’s 'Mount Aragats' (1925) is a seminal work of Armenian Expressionist landscape painting. Sarian, recognized as the founder of a modern Armenian national school of painting, drew heavily on his travels to Armenia and the Middle East for inspiration (Source 4). The work reflects his deep admiration for nature, influenced by his childhood in rural settlements (Source 4). As an Expressionist landscape, it likely prioritizes emotional resonance and color intensity over strict topographical accuracy, aligning with the broader tradition where landscape views may be 'entirely imaginary, or copied from reality with varying degrees of accuracy' (Source 1). The painting serves as a nationalist statement, consistent with the early 20th-century tendency to express the special nature of the homeland’s landscape (Source 7).

estimated time

20-30 hours over 5-7 sessions

materials

7 items

steps

6 in sequence

materials

item	purpose	modern equivalent
Oil paints (artist grade)	Primary medium for the painting	—
Linseed oil	To mix with paint for thinning and adhering; essential for 'fat over lean' layering	—
Mineral spirits or turpentine	Solvent for thinning initial layers and cleaning brushes	—
Canvas	Support surface	—
Charcoal or thinned paint	For initial sketching of the composition	—
Paintbrushes and/or palette knives	Application of paint; knives allow for scraping and textural application	—
Rags	For wiping away wet paint or adjusting texture	—

preparation

surface prep

Prepare a standard oil-primed canvas. While specific priming methods for Sarian are not detailed in the sources, traditional oil painting techniques assume a prepared surface to accept the oil medium (Source 2).

underdrawing

Begin by sketching the subject onto the canvas using charcoal or thinned paint (Source 2). Sarian’s work was inspired by his travels, so the drawing should capture the essence of the Armenian landscape rather than a rigid topographical map, as landscape views in art can be imaginary or loosely based on reality (Source 1).

underpainting

Apply an initial layer of thinned paint (lean layer) to establish the basic forms and values. This aligns with traditional oil painting techniques where the artist sketches and begins with thinner applications (Source 2).

color palette

Vibrant Earth Tones

Ochres, Umbers, Siennas

General use in Sarian’s palette, reflecting his inspiration from Armenian landscapes and nature (Source 4)

Intense Blues and Greens

Ultramarine, Phthalo Blue, Viridian

Sky and vegetation, consistent with Expressionist emphasis on color emotion rather than strict realism (Source 1, Source 4)

Warm Highlights

Cadmium Yellow, Orange

Capturing the light and spiritual element often associated with landscape art (Source 1)

composition

The composition should arrange natural scenery elements (mountains, sky) into a coherent whole (Source 1). Sarian’s landscapes often served as nationalist statements, so the scale and grandeur of Mount Aragats should be emphasized to reflect the 'special nature of the landscape of the homeland' (Source 7). The sky is almost always included in landscape views and should be a significant compositional element (Source 1).

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

step 01
Sketch the outline of Mount Aragats and the surrounding landscape using charcoal or thinned paint.
Tip — Keep lines loose to allow for expressive changes later.
Traditional oil painting sketching

underpainting

step 02
Apply a thin, lean layer of paint to block in major color areas and values.
Tip — Ensure this layer has less oil than subsequent layers to prevent cracking.
Lean underpainting

first pass

step 03
Build up the mountain forms with thicker paint, using brushes or palette knives.
Tip — Each additional layer should contain more oil than the layer below.
Fat over lean

refining

step 04
Adjust colors and textures to enhance the expressive quality of the landscape.
Tip — Use palette knives to scrape or add texture if needed, as oil paint remains wet long enough for adjustments.
Expressive brushwork

finishing

step 05
Finalize details and ensure the composition conveys the spiritual or emotional weight of the landscape.
Tip — Focus on the coherence of the composition and the impact of color contrasts.
Expressionist finish

varnishing

step 06
Allow the painting to dry completely (up to two weeks) before applying varnish if desired.
Tip — Oil paint dries by oxidation, not evaporation.
Oil drying process

critical techniques

Fat over Lean

A basic rule of oil paint application where each additional layer contains more oil than the previous one to ensure proper drying and prevent cracking.

Expressive Color Use

Sarian’s Expressionist style likely involves using color to convey emotion and national identity rather than strict realism, consistent with the Romantic and Expressionist traditions of landscape painting.

Palette Knife Application

Using palette knives to apply or scrape paint, allowing for varied texture and the ability to change form while the paint is wet.

common pitfalls

→Applying lean layers over fat layers, which can cause the painting to crack and peel (Source 2).
→Overworking the paint before it dries, leading to muddy colors; remember oil paint remains wet longer than other materials, allowing for changes but requiring patience (Source 2).
→Ignoring the 'fat over lean' rule, which is critical for the stability of the paint film (Source 2).
→Focusing too much on topographical accuracy rather than the expressive or spiritual element of the landscape, which is central to Sarian’s style and the broader landscape tradition (Source 1, Source 4).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

·Specific color palette used by Sarian for 'Mount Aragats' is not detailed in the sources; general Expressionist and Armenian landscape conventions are inferred.
·Exact brushwork or texture techniques specific to this painting are not described; general oil painting techniques are applied.
·Sarian’s specific preparatory sketches or underpainting methods for this work are not documented in the provided sources.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

Wikipedia: Oil painting↗
- part 2 — applied to Underdrawing, underpainting, fat over lean rule, palette knife use, drying time
Wikipedia: Landscape painting↗
- part 1 — applied to Composition, inclusion of sky, imaginary vs. real views, spiritual element
- part 7 — applied to Nationalist statement in landscape painting
Wikipedia bio — Martiros Sarian↗
- part 1 — applied to Artist’s inspiration, national school of painting, admiration for nature

Read more about the corpus on the sources page and how the guides are built on the methods page.

read from the painting

observed from the image, not the label

6 dominant colors, measured

what the eye sees

Mount Aragats dominates the upper half, rendered in deep purples and browns with white snow catching frontal light. The composition is rigidly horizontal: a violet mountain mass sits against a cool sky with cream-white clouds, then drops decisively into golden-yellow agricultural fields sectioned by crisp teal-green lines. The eye travels from the mountain silhouette down through the geometric field patterns, finally landing on a procession of black cattle and figures in the immediate foreground—the darkest, smallest, and most active element. The lighting is frontal and shadowless overall, creating a flat, almost heraldic quality typical of Expressionist landscape.

value structure

Four distinct value zones: the mountain is mid-dark (purples and browns around value 4-5), the sky and clouds are light-to-mid (around 6-7), the fields are uniformly bright yellow-cream (around 7-8), and the animal silhouettes are nearly black (value 1-2). When you squint, the mountain reads as a single dark mass, the fields as a unified bright zone, and the foreground animals as a sharp visual punctuation. No gradation within zones—each area is relatively flat in value, which is key to the expressionist geometry.

observed palette and mixes

#757a7d
Titanium white + ultramarine + raw umber
Sky underpainting, mountain-field transitions, overall mid-tone structure
#544e4b
Alizarin crimson + ultramarine + raw umber
Deep mountain shadows, darkest field recessions
#e3d483
Cadmium yellow light + titanium white + ochre
Lit plowed fields, primary foreground brightness
#afa481
Yellow ochre + ultramarine, desaturated
Mid-tone field areas, mountain base transitions
#958461
Burnt sienna + ultramarine + cadmium yellow
Mountain mid-tones, warm rock faces
#c3bc8d
Cadmium yellow + titanium white + touch of raw umber
Lighter field passages, illuminated ground
#6b2d7b
Ultramarine + alizarin crimson + touch of black
Deep purple mountain shadows, cone's shaded side
#1a1a1a
Ultramarine + alizarin + black
Animal silhouettes, deepest field shadows, dark accents

edges and brushwork

Edges are uniformly sharp and geometric throughout—the field division lines are crisp teal-green strokes defining the landscape's rigid structure, with almost no feathering or softness. Brushwork is matter-of-fact and relatively flat; the application appears direct with minimal texture or visible stroke direction, letting the bold color relationships and clean outlines carry the visual weight. Only around the snow and cloud masses is there any hint of softer transition, but even these are restrained and geometric rather than atmospheric.

a working sequence

01
Underpaint and value framework
Tone the entire canvas with a warm gray (mix of ultramarine, raw umber, and white). Work quickly to establish the overall mid-value. This neutral base will help you judge both the cool mountain purples and warm field yellows as you build up. Don't worry about detail—this is purely a value foundation.
02
Mountain structure and core shadow
Block in the mountain mass using a deep purple made from ultramarine and alizarin crimson, slightly grayed with a touch of raw umber. Keep the left side (shadow side) darker and more purple; begin establishing the mountain's cone shape. Leave the peak uncolored for now. This dark, cool mass will anchor the whole composition.
03
Mountain highlights and snow
Paint the snow-capped peak and the bright yellow-cream edge where the mountain face turns toward light. Mix a warm ochre-yellow for the lit rock face (cadmium yellow + ochre + touch of burnt sienna). The contrast between deep purple shadow and this warm light edge creates the mountain's three-dimensionality. Keep the snow pure white with only the faintest blue shadow.
04
Sky and clouds
Fill the sky with a cool blue-gray (ultramarine + titanium white), keeping it slightly darker near the horizon. Add the white cloud mass on the right with pure white and cream (white + touch of yellow). The clouds should be volumetric but still geometric—no fluffy softness, just clean rounded forms. The sky-to-horizon should suggest atmospheric perspective without gradient.
05
Field base and geometric divisions
Paint the entire field area with a bright, warm yellow-cream (cadmium yellow light + white + touch of ochre). Then immediately begin laying the field division lines in a teal-green (ultramarine + cadmium yellow with a touch of black). These lines must be crisp and angular, following the perspective of the land—they recede toward the horizon and create the essential geometric rhythm. Don't blend; let the colors sit adjacent.
06
Field depth and mid-ground vegetation
Refine the field planes using slightly darker ochre (yellow ochre + touch of ultramarine) in the receding middle distance. Paint the clustered green trees as simple dark green mass (ultramarine + cadmium yellow + black), keeping them compact and silhouetted. Add thin lines of trees (poplar-like) using the same dark green and thin brushstrokes—these should feel distant and linear, not detailed.
07
Foreground field patterns and red accent
Add the darker field shadows and linear patterns in the near foreground using the teal-green and darker ochres, following the geometric grid established earlier. Add the warm red-orange accent visible in the lower left using alizarin crimson + cadmium yellow; this warm note punctuates the cool-warm rhythm. Keep all marks crisp and avoid softening edges.
08
Animal silhouettes and figures
Paint the cattle and herders in the immediate foreground as pure black silhouettes (ultramarine + alizarin + black)—keep them relatively small and linear, almost like simple shapes moving across the field. They should read as a dark thread against the bright yellow foreground. Don't model them; the simplified profile is the point.
09
Final edges and accents
Step back and assess the overall geometric clarity. Sharpen any field-to-mountain transitions that feel soft, reinforce the darkest mountain shadows, and ensure the field lines read as crisp divisions. Add any small warm accents (touches of orange or rust) in the lower fields to enliven the yellows. Trust the underpainting structure you've built—your work is done when the geometric composition reads clearly.

where studies of this painting go wrong

The mountain's purple must be restrained and contain brown-gray undertones, or it becomes theatrical and loses credibility; resist pure violet and lean into ultramarine + alizarin + a healthy dose of raw umber.
The field division lines must stay crisp and geometric; any softening or blending destroys the expressionist punch and makes the landscape feel atmospheric rather than constructed.
The animal silhouettes are easy to overcomplicate—they should be minimal black shapes, not detailed, or they will draw the eye away from the composition's intended focus on land and mountain.
The yellow fields can easily turn muddy or olive when you add shadows; maintain luminosity by using cooler ochres and teal-greens for shadow rather than mixing mud, and ensure your lights stay warm and pure.

measured difficulty