apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·A view of Blaricum
A view of Blaricum by Gustave de Smet

plate no. 5874

A view of Blaricum

Gustave de Smet, 1917

oilExpressionismlandscapelandscapevillagefieldsskycloudschurch

recreation guide

Gustave de Smet’s *A view of Blaricum* (1917) represents a pivotal moment in his transition toward Flemish Expressionism, created during his exile in the Netherlands during World War I. The work is characterized by a departure from naturalistic imitation toward 'pure expression,' utilizing distorted forms and a saturated palette influenced by the Bergen School and German Expressionism (Source 4, Source 5). Rather than capturing the topographical accuracy of the Dutch landscape, De Smet employed simplified lines and shapes to create a well-organized, balanced structure that augmented the expressive quality of the scene (Source 5). The painting likely features the warm autumnal tones and broad brushstrokes that defined his style during this period, creating solid masses of paint rather than delicate details (Source 5).

estimated time

20-30 hours over 5-7 sessions

materials

5 items

steps

6 in sequence

materials

itempurposemodern equivalent
Oil paints (warm autumnal tones, blacks, whites)Primary medium for the expressive color application—
Linseed oilMedium for glazing and scumbling techniquesStand oil or refined linseed oil
Spirits of turpentineThinner for initial layers to ensure fast drying and absorbencyOdorless mineral spirits
Canvas or wood panelSupport for the oil paintingLinen canvas primed with gesso
Brushes (various sizes)Applying broad brushstrokes and solid masses of paintHog bristle brushes for impasto, sable for glazing

preparation

surface prep

The surface should be prepared to accept oil paints. While specific preparation for this exact canvas is not detailed, De Smet’s practice involved working with solid masses of paint. A standard oil ground is appropriate. If employing the glazing techniques mentioned in general oil painting practice, a dry, absorbent ground is beneficial for the initial layers (Source 7).

underdrawing

De Smet’s style during this period emphasized simplified lines and shapes to create structure (Source 5). The underdrawing should likely be minimal, focusing on the essential contours and massing of the landscape elements rather than detailed topographical accuracy. Contour drawing principles suggest emphasizing mass and volume over minor details (Source 8).

underpainting

A monochrome underpainting (grisaille) may be employed to establish tone and value before applying color. This technique allows the artist to mentally extract specific hues and focus on the structural composition. Once dry, this layer serves as a foundation for glazing and scumbling (Source 3).

color palette

Warm autumnal tones

Yellow ochre, burnt umber, vermilion, rose madder

General use in this artist's palette during the Blaricum period, reflecting the influence of the Bergen School

Blacks and dark tones

Ivory black, burnt umber

Creating solid masses and chiaroscuro effects, applied in broad brushstrokes

Whites

Titanium white or lead white (historical)

Highlighting and balancing the composition, consistent with the use of two whites in direct painting

Saturated hues

Ultramarine, emerald, cobalt

Expressive coloration, potentially used in glazes to modify the underlying tones

composition

The composition likely emphasizes a well-organized and balanced structure, a hallmark of De Smet’s work during this period (Source 5). The landscape elements are arranged to create a coherent whole, with simplified shapes and forms that prioritize expressive impact over realistic detail. The sky is likely included as a significant element, contributing to the overall mood and color harmony (Source 6).

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

  1. step 01

    Sketch the basic contours and masses of the landscape using simplified lines. Focus on the overall structure and balance rather than detailed features.

    Tip — Emphasize mass and volume; avoid getting lost in minor details.

    Contour drawing

underpainting

  1. step 02

    Apply a monochrome underpainting (grisaille) to establish the tonal values of the composition. Use black, white, and perhaps a neutral tone to define light and shadow.

    Tip — Ensure the underpainting is completely dry before proceeding to color layers.

    Grisaille

first pass

  1. step 03

    Begin applying color using broad brushstrokes. Focus on the warm autumnal tones and blacks characteristic of De Smet’s style. Use turpentine-thinned paint for the initial layers to ensure fast drying.

    Tip — Watch for the paint becoming too 'soapy' if too much oil is used; turpentine helps keep the surface absorbent.

    Direct painting (prima)

refining

  1. step 04

    Apply glazes and scumbles to modify the colors and enhance the expressive quality. Use transparent coats of color (glazing) and semi-opaque layers (scumbling) to create depth and harmony.

    Tip — Glazing over a darker ground can create a coldness or grey bloom; use this effect intentionally for atmospheric depth.

    Glazing and scumbling

finishing

  1. step 05

    Refine the composition by adjusting the balance of colors and tones. Ensure that the simplified shapes and solid masses of paint contribute to the overall expressive impact.

    Tip — Consider the simultaneous contrast of colors; adjacent hues will influence each other’s appearance.

    Color harmony

varnishing

  1. step 06

    Once the painting is completely dry, apply a varnish to protect the surface and enhance the depth of the colors.

    Tip — Ensure the painting is fully cured to avoid trapping solvents beneath the varnish.

    Varnishing

critical techniques

Glazing and Scumbling

Used to modify the underlying monochrome layer and create depth and harmony. Glazing involves transparent coats of color, while scumbling uses semi-opaque layers. This technique was common among old masters and is useful for achieving the desired expressive effects in De Smet’s style.

Simultaneous Contrast

Understanding how adjacent colors influence each other’s appearance is crucial for achieving the desired color harmony. De Smet’s saturated palette and expressive coloration rely on this principle to create visual impact.

Broad Brushstrokes

De Smet applied paint in broad brushstrokes to create solid masses, a characteristic of his expressionist style during the Blaricum period. This technique emphasizes the physicality of the paint and the expressive quality of the work.

common pitfalls

  • →Overworking the paint: De Smet’s style relies on solid masses and broad strokes. Over-blending can lose the expressive impact.
  • →Ignoring color contrast: Failing to account for simultaneous contrast can result in muddy or dull colors. Adjacent hues will influence each other, so plan the palette carefully.
  • →Using too much oil in early layers: This can lead to a 'soapy' surface and slow drying. Use turpentine for initial layers to maintain absorbency.
  • →Focusing on topographical accuracy: De Smet moved away from realistic imitation. Prioritize expressive structure and color over detailed realism.

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific details of the landscape in *A view of Blaricum* (e.g., specific buildings, trees, or weather conditions) are not described in the sources, so the composition must be inferred from general style notes.
  • ·The exact pigments used by De Smet in 1917 are not specified, so modern equivalents are suggested based on general practice.
  • ·The specific preparatory methods (e.g., type of ground, exact underdrawing technique) for this particular painting are not documented.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • Laws of Contrast of Colour↗

    • Chapter 6 — applied to Understanding simultaneous contrast and color harmony in the palette
  • The Practice of Oil Painting↗

    • Colouring a Monochrome — applied to Techniques for glazing and scumbling over a grisaille underpainting
    • Painting in Colour Direct from Life — applied to Advice on using turpentine for initial layers to prevent soapy surfaces

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia bio — Gustave de Smet↗

    • Part 1 and Part 2 — applied to Context on De Smet’s style, influences, and use of broad brushstrokes and saturated palettes
  • Wikipedia: Contour drawing↗

    • Part 1 — applied to Principles of emphasizing mass and volume in the underdrawing

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

Dolly Sisters

Dolly Sisters

Kees van Dongen

Nude with Loaves

Nude with Loaves

Jean Helion

My Father

My Father

Carlos Botelho

Helen

Helen

Chronis Botsoglou

The portrait painter in the country

The portrait painter in the country

Albin Egger-Lienz

Marketta on Lázeňská street, Prague

Marketta on Lázeňská street, Prague

Maria Bozoky

Winter at the Entrepotdok, in Amsterdam city

Winter at the Entrepotdok, in Amsterdam city

Paul Werner

Old Woman with Masks (Theatre of Masks)

Old Woman with Masks (Theatre of Masks)

James Ensor