apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·View of Bottom and MeudonBillancourt
View of Bottom and MeudonBillancourt by Henri Rousseau

plate no. 3155

View of Bottom and MeudonBillancourt

Henri Rousseau, 1890

oil, canvasNaïve Art (Primitivism)landscapelandscapevillagetreesfieldsskyfigures

recreation guide

Henri Rousseau’s 'View of Bottom and Meudon/Billancourt' (1890) is a landscape executed in oil on canvas, reflecting his transition from academic ridicule to recognition as a self-taught genius of the Naïve or Primitive manner (Source 3). Unlike his later jungle scenes, this work belongs to his concurrent output of smaller topographical images of Paris and its suburbs (Source 7). The painting is distinctive for its flat, seemingly childish style, which critics often disparaged but which demonstrates a sophisticated control of tone and form despite the lack of academic training (Source 7). Rousseau’s approach relies on the inherent vitality of the oil medium, using it not merely to deceive the eye with illusionistic realism, but to express feeling through painted symbols that remain true to the material’s properties (Source 2). The work likely exhibits the 'richer and denser color' and layering capabilities afforded by oil painting, allowing for a wide range from light to dark (Source 1).

estimated time

20-30 hours over 5-7 sessions

materials

6 items

steps

5 in sequence

materials

itempurposemodern equivalent
Oil paints (pigments combined with drying oil)Primary medium for painting, offering flexibility and rich color density.Standard tube oil paints mixed with linseed or walnut oil.
CanvasSupport surface, consistent with the common use of oil painting on canvas for several centuries.Primed cotton or linen canvas.
Linseed oil or Walnut oilBinder for pigments; provides specific drying times and sheen properties.Refined linseed oil or walnut oil.
TurpentineThinner for the paint, allowing for initial washes or glazes.Odorless mineral spirits or pure gum turpentine.
Earth pigments (ochres, umbers)Rousseau’s palette likely relied on substantial, fixed earths for broken tones and covering power, as suggested by the utility of such materials in landscape work.Yellow Ochre, Raw Umber, Burnt Sienna.
White Lead or Titanium WhiteFor highlights and mixing lighter tones; historically significant in oil painting.Titanium White (non-toxic equivalent).

preparation

surface prep

The canvas should be prepared with a ground suitable for oil painting. While Rousseau’s specific priming technique is not detailed in the sources, the general practice of the period involved preparing the surface to accept oil layers. The artist must respect the 'vital qualities' of the medium, ensuring the surface does not inhibit the plasticity of the paint (Source 2).

underdrawing

Rousseau’s preparatory methods are not explicitly described in the provided sources. However, given his self-taught status and the 'flatness' of his style, he likely employed a direct approach or a light underdrawing that did not dominate the final mass of paint. The sources suggest that students often fear losing outlines, but Rousseau’s work implies a confidence in placing tone masses directly (Source 5).

underpainting

There is no specific evidence in the sources that Rousseau used a grisaille or monochrome underpainting for this specific landscape. However, the general technique of oil painting allows for layers (Source 1). If an underpainting is used, it should be kept simple to allow the 'richer and denser color' of the final layers to emerge (Source 1).

color palette

Earth Tones (Ochres, Umbers)

Natural and burnt ochres, umber

General use in landscape elements; earths provide 'perfect fixedness' and 'covering well' for broken tones (Source 4).

Greys and Cool Tones

Black, white, and potentially ultramarine or blue earths

Creating 'grey bloom' or coldness in shadows, consistent with scumbling techniques over darker grounds (Source 8).

Vibrant Greens/Blues

Verdigris, Indigo, or mixed greens

Foliage and sky; Rousseau’s style often features distinct, non-blended color areas.

composition

The composition likely reflects Rousseau’s topographical interest in the suburbs of Paris (Source 7). While specific compositional moves for this painting are not detailed, his general style is characterized by flatness and a reduction of appearances to tone masses rather than strict linear perspective (Source 5). The artist should aim to reduce the solid objects of the landscape to terms of a flat surface, avoiding the 'muddling through' method that results from confusing line and mass studies (Source 5).

step by step

underdrawing→first pass→refining→finishing

underdrawing

  1. step 01

    Lightly sketch the main forms of the landscape on the canvas. Focus on reducing the scene to flat shapes and tone masses rather than detailed outlines.

    Tip — Avoid clinging to outlines; focus on the accuracy of values and shapes of masses (Source 5).

    Mass drawing

first pass

  1. step 02

    Apply initial layers of paint using oil mixed with turpentine. Establish the basic color fields and tonal values. Use earth pigments for grounding tones.

    Tip — Utilize the 'greater flexibility' of oil to adjust forms. Ensure the paint has sufficient plasticity to be molded into textures (Source 1).

    Direct painting / Layering

refining

  1. step 03

    Build up color density. Apply opaque layers for highlights and mid-tones. Use the 'richer and denser color' capability of oil to create depth without relying on illusionistic trickery.

    Tip — Remember that art is an expression of feeling, not a substitute for nature. Keep the painted symbols true to the emotional idea (Source 2).

    Opaque layering

  2. step 04

    If needed, use glazing or scumbling to adjust tones. Scumbling semi-opaque paint over darker grounds can create a 'grey bloom' or coldness in shadows.

    Tip — Be cautious with glazing; ensure underlying layers are dry to avoid muddying colors (Source 8).

    Scumbling

finishing

  1. step 05

    Review the painting for balance of tone masses. Ensure the flatness of the style is maintained, avoiding excessive modeling that would betray the 'Naïve' aesthetic.

    Tip — Check that the 'vital expression of nature' is achieved through the medium’s vitality, not just visual deception (Source 2).

    Tone study

critical techniques

Reduction to Tone Masses

Rousseau’s style benefits from viewing the landscape as flat planes of color and value rather than detailed linear drawings. This avoids the confusion of mixing line and mass studies (Source 5).

Use of Earth Pigments

Incorporating ochres and earths provides stability and covering power, essential for the broken tones often found in landscapes (Source 4).

Layering and Plasticity

Exploiting the oil medium’s ability to be molded into different textures and layered for richer color density (Source 1).

common pitfalls

  • →Attempting to create a meretricious illusion of nature rather than expressing feeling through the medium’s vitality (Source 2).
  • →Confusing line drawing with mass drawing, leading to 'muddling through' and a lack of structural clarity in tone values (Source 5).
  • →Overworking the paint, losing the 'flatness' that gives strength to the forms in Rousseau’s Naïve style (Source 5, Source 7).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific pigment palette used by Rousseau for this 1890 landscape is not detailed in the sources.
  • ·Exact brushwork techniques (e.g., brush size, stroke direction) are not described.
  • ·Whether Rousseau used a specific underpainting method (grisaille) for this work is unknown.
  • ·Details of the specific view (Bottom and Meudon/Billancourt) are not visually described in the text, so compositional specifics must be inferred from general style.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice and Science of Drawing↗

    • XX MATERIALS — applied to Philosophy of using medium’s vitality rather than illusionism.
    • STUDY BY RUBENS... — applied to Technique of reducing forms to tone masses and avoiding outline dependency.
  • The Science of Painting↗

    • CHAPTER V. COLOURING SUBSTANCES — applied to Use of earth pigments and ochres.
  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Scumbling and glazing techniques for tone adjustment.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Oil painting↗

    • part 1 — applied to Materials, layering, and plasticity of oil paint.
  • Wikipedia bio — Henri Rousseau↗

    • part 1 & part 4 — applied to Artist’s style, Naïve classification, and topographical output.

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

Shepherd and his Lover

Shepherd and his Lover

Bertalan Por

The sketch to the movie "Colour of Pomegranate". "Muse"

The sketch to the movie "Colour of Pomegranate". "Muse"

Sergei Parajanov

Surprised!

Surprised!

Henri Rousseau

Holy Mountain I

Holy Mountain I

Horace Pippin

Gibraltar

Gibraltar

Alfred Wallis

Willage. Horse Taming

Willage. Horse Taming

Victor Palmov

Old Corn Mill, Keighley

Old Corn Mill, Keighley

John Bradley

Winter Still Life with Candle

Winter Still Life with Candle

Mary Fedden