apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·The Village of Vosges
The Village of Vosges by Albert Marquet

plate no. 8563

The Village of Vosges

Albert Marquet, 1893

oilPost-Impressionismlandscapelandscapetreesfieldskyvillagebuildings

recreation guide

Albert Marquet’s *The Village of Vosges* (1893) represents an early work from his formative period, preceding his later association with Fauvism and his mature Impressionist style (Source 7). As a landscape painting, it falls within the tradition of depicting natural scenery and wide views, where the sky and weather often serve as integral compositional elements (Source 6). While specific visual details of this particular 1893 canvas are not described in the provided sources, Marquet’s general practice involved a transition from early academic influences toward a more personal interpretation of light and atmosphere. The recreation should focus on the structural integrity of the landscape and the atmospheric handling of light, consistent with the Post-Impressionist emphasis on capturing the 'modifications of the light on the model' (Source 2).

estimated time

20-30 hours over 5-7 sessions

materials

5 items

steps

5 in sequence

materials

itempurposemodern equivalent
Oil paints (White Lead or Titanium White, Yellow Ochre, Red Ochre, Ultramarine, Black)Primary palette for underpainting and glazing, consistent with historical practices mentioned in sources.Titanium White (safer alternative to White Lead), Cadmium Yellow/Red (if ochres are insufficient for intensity), Phthalo Blue (alternative to Ultramarine)
Linseed OilMedium for mixing paints and creating glazes, adhering to the 'fat over lean' principle.Refined Linseed Oil
Turpentine or Mineral SpiritsThinner for initial washes and cleaning brushes; used to create lean initial layers.Odorless Mineral Spirits (OMS)
Canvas or Wood PanelSupport for the oil painting.Linen canvas primed with gesso
Charcoal or Thinned PaintFor initial sketching and underdrawing.Vine charcoal or diluted oil paint

preparation

surface prep

Prepare the canvas with a traditional oil ground or modern acrylic gesso. While the sources do not specify Marquet’s exact ground for this 1893 work, traditional oil painting techniques often begin with a prepared surface to ensure proper adhesion and drying (Source 8). If aiming for historical accuracy regarding old master techniques mentioned in the texts, a warm-toned ground might be considered to aid in value judgment, though this is inferred from general practice rather than specific evidence for Marquet.

underdrawing

Sketch the composition using charcoal or thinned paint. Traditional oil painting techniques often begin with the artist sketching the subject onto the canvas with charcoal or thinned paint (Source 8). Marquet’s early work likely involved careful structural planning before applying color, consistent with the advice to be a 'sound craftsman' who knows his medium (Source 3).

underpainting

Consider using a grisaille (monochrome underpainting) technique. Source 1 discusses 'colouring a monochrome,' where the artist mentally extracts red and yellow colors, translating what would be left in nature if these two colors were not present. This grisaille should be allowed to dry completely before proceeding. This method helps establish values and composition without the distraction of color, a technique practiced by old masters and recommended for mastering the medium (Source 1).

color palette

White

White Lead or Titanium White

Highlights and mixing; historically one of the four basic colors used by ancient artists (Source 4).

Yellow Ochre

Natural Yellow Ochre

Earth tones, foliage, and warm highlights; one of the four basic colors historically used (Source 4).

Red Ochre

Natural or Burnt Red Ochre

Warm accents, roofs, and earth tones; one of the four basic colors historically used (Source 4).

Black

Ivory Black or Lamp Black

Shadows and depth; one of the four basic colors historically used (Source 4).

Ultramarine

Ultramarine Blue

Sky and cool shadows; mentioned in Reynolds’ method for initial paintings (Source 1).

composition

As a landscape, the composition likely includes a wide view with sky as an almost always included element (Source 6). The artist should aim to harmonize colors inherent to the nature of the objects, such as the sky and earth, while considering the law of simultaneous contrast to ensure that adjacent colors enhance each other’s intensity and tone (Source 2). The composition should avoid arbitrary color choices, instead substituting true colors with those from a neighboring scale if necessary to maintain harmony (Source 5).

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

  1. step 01

    Sketch the main elements of the village and landscape using charcoal or thinned paint.

    Tip — Focus on accurate proportions and placement of key elements.

    Traditional underdrawing

underpainting

  1. step 02

    Apply a grisaille underpainting using black, ultramarine, and white to establish values. Mentally extract red and yellow colors to focus on form and light.

    Tip — Ensure the underpainting is completely dry before proceeding to avoid muddying colors.

    Grisaille

first pass

  1. step 03

    Begin glazing and scumbling with oil, applying yellow and red tones as they occur in nature. Use transparent coats of color (glazing) and semi-opaque painting (scumbling) to build up color.

    Tip — Glazing adds depth and luminosity, while scumbling can create a grey bloom or coldness over darker grounds.

    Glazing and Scumbling

refining

  1. step 04

    Adjust colors based on the law of simultaneous contrast. Observe how adjacent colors affect each other’s appearance and modify tones accordingly to harmonize the composition.

    Tip — Be aware that the eye may see colors inaccurately due to mixed contrast; take breaks to reset visual perception.

    Simultaneous Contrast

finishing

  1. step 05

    Finalize details and ensure that the gradation of light and color is consistent. Check for any areas where the underlying painting makes itself felt through scumbling.

    Tip — Ensure that each additional layer contains more oil than the layer below to prevent cracking (fat over lean).

    Final Adjustments

critical techniques

Glazing and Scumbling

Used to build up color and texture. Glazing involves transparent coats of color, while scumbling is semi-opaque painting that allows the underlying layer to show through. This method was practiced by old masters and is recommended for mastering oil painting (Source 1).

Simultaneous Contrast

Understanding how adjacent colors affect each other’s appearance is crucial for harmonizing the composition. The painter must appreciate the color peculiar to each part and the modifications of tone and color received from contiguous colors (Source 2).

Fat Over Lean

Each additional layer of paint should contain more oil than the layer below to allow proper drying and prevent cracking. This is a basic rule of oil paint application (Source 8).

common pitfalls

  • →Applying layers with less oil than the previous layer, leading to cracking and peeling (Source 8).
  • →Ignoring the law of simultaneous contrast, resulting in colors that appear inaccurate or disharmonious (Source 2).
  • →Over-modeling or being too tied down to outlines, which can make the painting appear stiff. Copying works by artists like Reynolds or Van Dyck can help correct this tendency (Source 3).
  • →Using a theoretical palette exclusively, which may not be practicable due to chemical reactions and lack of ready-made colors. Earths, ochres, and marls are recommended for their fixedness and covering qualities (Source 4).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific visual details of *The Village of Vosges* (1893) are not described in the sources, so the recreation relies on general landscape painting principles and Marquet’s broader style.
  • ·Marquet’s specific palette for this early work is not detailed; the suggested palette is based on historical norms and general Post-Impressionist practices.
  • ·The exact medium and varnish used by Marquet in 1893 are not specified, though traditional oil painting techniques are assumed.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Underpainting and glazing techniques
    • ON COPYING — applied to Advice on correcting tendencies like over-modeling
  • Laws of Contrast of Colour↗

    • 315-318 — applied to Color harmony and simultaneous contrast
  • The Science of Painting↗

    • CHAPTER V. COLOURING SUBSTANCES — applied to Palette selection and historical color use

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Oil painting↗

    • Oil painting — part 2 — applied to General oil painting techniques and materials
  • Wikipedia bio — Albert Marquet↗

    • Albert Marquet — part 1 — applied to Artist’s style and period context
  • Wikipedia: Landscape painting↗

    • Landscape painting — part 1 — applied to Genre conventions and compositional elements

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

The Dinner Party

The Dinner Party

Jules-Alexandre Grun

La Fleuriste

La Fleuriste

Le Pho

Family on Vacation

Family on Vacation

Roman Selsky

Old wooden cottage in the snow

Old wooden cottage in the snow

Alfred Freddy Krupa

Paris Street

Paris Street

Maurice Utrillo

Grand bouquet of mimosa

Grand bouquet of mimosa

Moise Kisling

Versailles

Versailles

Alexandre Benois

Autumn Landscape with Birches

Autumn Landscape with Birches

Konstantin Gorbatov