apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Oak Grove. Illuminated by the sun.
Oak Grove. Illuminated by the sun. by Pyotr Konchalovsky

plate no. 8423

Oak Grove. Illuminated by the sun.

Pyotr Konchalovsky, 1920

oilPost-Impressionismlandscapetreeslandscapeskygrasswoodsfoliage

recreation guide

Pyotr Konchalovsky’s *Oak Grove. Illuminated by the sun* (1920) is a landscape executed in oil, reflecting his Post-Impressionist style and his foundational role in the Knave of Diamonds group (Source 5). Konchalovsky’s artistic development was heavily influenced by his study of Paul Cézanne and Vincent van Gogh in Paris, leading him to incorporate Fauvist elements and Cézannism into his work (Source 5). This period of his career is characterized by a synthesis of modern European breakthroughs with Russian primitivism, resulting in landscapes that prioritize structural form and vibrant, expressive color over strict topographical accuracy (Source 5). The title suggests a focus on natural light and foliage, consistent with the landscape genre’s tradition of depicting natural scenery such as trees and forests (Source 4).

estimated time

20-30 hours over 5-7 sessions

materials

8 items

steps

6 in sequence

materials

itempurposemodern equivalent
Oil paints (various pigments)Primary medium for the paintingStandard tube oil paints
Linseed oilDrying oil binder for pigments; general purpose mediumRefined linseed oil
TurpentineSolvent for thinning paint and cleaning brushesOdorless mineral spirits or turpentine
Raw umberFor setting the palette and initial monochrome underpaintingRaw umber pigment
White pigment (likely Lead White historically, Titanium Zinc modern)For mixing tints and highlights; historically valued for opacityTitanium White or Zinc White
CharcoalFor initial drawing and shading before paint applicationVine charcoal or compressed charcoal
Canvas or linen supportSurface for paintingPrimed linen or cotton canvas
BrushesApplication of paint and charcoalHog bristle and synthetic brushes

preparation

surface prep

The support is likely linen or canvas, consistent with the use of linen as a 'support' for oil painting derived from the flax plant (Source 2). While specific priming instructions for this exact work are not detailed in the sources, standard practice involves preparing the surface to accept oil paint. Konchalovsky’s training at the Imperial Academy and Académie Julian would have instilled standard preparatory methods for oil on canvas.

underdrawing

Begin with a charcoal drawing to establish the composition and structure of the oak grove. Shade in the charcoal to model forms before applying paint. It is critical to make all corrections during this charcoal stage, as charcoal offers little resistance to a brush and can be easily removed with bread, whereas correcting errors in paint is 'fatal to lucidity' (Source 1). Hold the drawing alongside the subject (or reference) to compare scale and proportions, ensuring the study is slightly smaller than life if painting from a model or direct observation (Source 1).

underpainting

Set the palette with raw umber and a softer white, using turpentine to thin the paint (Source 1). Apply a monochrome underpainting (grisaille) to establish the tonal values of the landscape. This step involves mentally extracting red and yellow colors to focus on the underlying structure and light/shadow relationships (Source 3). This monochrome layer should be allowed to dry completely before proceeding to color application.

color palette

Raw Umber

Raw umber pigment

Underpainting and setting the palette

White

Lead White (historical) or Titanium/Zinc White (modern)

Highlights and mixing tints; historically dominant for opacity

Yellow and Red tones

Various yellow and red pigments

Glazing and scumbling to introduce color, particularly in foliage and sunlight effects

Black and Ultramarine

Black and Ultramarine pigments

General use in the artist's palette for shadows and depth, consistent with Reynolds' method cited in sources

composition

The composition likely features a wide view of natural scenery, including trees and possibly sky, arranged into a coherent composition typical of landscape painting (Source 4). Konchalovsky’s style, influenced by Cézanne, emphasizes structural solidity and the interplay of light and form. The title 'Illuminated by the sun' suggests a focus on lighting effects, which should be addressed through the manipulation of color and value rather than just local color. Specific compositional details of this particular painting are not described in the sources, so general principles of landscape composition and Konchalovsky’s known stylistic tendencies are applied.

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

  1. step 01

    Draw the composition of the oak grove in charcoal, shading to model forms. Compare the drawing to the reference or subject to ensure accurate proportions.

    Tip — Make all corrections in charcoal before applying paint to avoid muddying the final image.

    Charcoal drawing and shading

underpainting

  1. step 02

    Mix raw umber and white with turpentine. Apply a monochrome underpainting to establish values, focusing on the structure of the trees and light.

    Tip — Ensure this layer is completely dry before adding color to prevent mixing issues.

    Monochrome underpainting (grisaille)

first pass

  1. step 03

    Begin applying color using glazing and scumbling techniques. Glaze transparent coats of yellow and red tones over the dry monochrome layer to introduce warmth and sunlight effects.

    Tip — Glazing involves applying a transparent coat of color, allowing the underlying layer to show through.

    Glazing

refining

  1. step 04

    Use scumbling to apply semi-opaque paint, particularly for highlights and textured areas like foliage. This technique allows the underlying painting to influence the final appearance.

    Tip — Scumbling over a darker ground can create a cold, grey bloom effect, useful for atmospheric depth.

    Scumbling

finishing

  1. step 05

    Continue to build up layers, going over the painting at least three or four times to achieve the desired depth and luminosity. Adjust colors and values as needed.

    Tip — One painting session will not suffice; plan for multiple sessions to allow for drying and refinement.

    Layering

varnishing

  1. step 06

    Once the painting is completely dry, apply a varnish to protect the surface and enhance the colors. This step is consistent with traditional oil painting practices.

    Tip — Ensure the painting is fully dry to prevent trapping solvents.

    Varnishing

critical techniques

Glazing

Applying transparent coats of color over a dry underpainting to build up luminosity and depth. This technique was practiced by old masters and is recommended for introducing yellow and red tones (Source 3).

Scumbling

Applying semi-opaque paint to allow the underlying layer to show through, useful for creating texture and atmospheric effects (Source 3).

Monochrome Underpainting

Establishing values and structure with a single color (raw umber) before adding color, ensuring correct construction before committing to paint (Source 1, Source 3).

common pitfalls

  • →Putting down paint with obvious errors in construction or drawing, which is 'reckless in the extreme' and leads to muddiness (Source 1).
  • →Attempting to complete the painting in one session; multiple layers and sessions are necessary for depth and correction (Source 1).
  • →Ignoring the drying time of the monochrome underpainting, which can cause issues when glazing or scumbling over it (Source 3).
  • →Using linseed oil for white pigments if yellowing is a concern, as lighter colors may yellow less with safflower, walnut, or poppyseed oil (Source 2).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific color palette used by Konchalovsky for this particular painting is not detailed in the sources.
  • ·Exact compositional layout of *Oak Grove. Illuminated by the sun* is not described in the provided passages.
  • ·Specific brushwork techniques unique to Konchalovsky’s handling of foliage are not detailed.
  • ·The exact type of ground or primer used on the canvas for this work is not specified.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • PAINTING FROM LIFE — applied to Underdrawing, underpainting, and layering techniques
    • COLOURING A MONOCHROME — applied to Glazing, scumbling, and monochrome underpainting

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Oil painting↗

    • Oil painting — part 4 — applied to Materials and medium characteristics
  • Wikipedia bio — Pyotr Konchalovsky↗

    • Pyotr Konchalovsky — part 1 — applied to Artist’s style, influences, and historical context
  • Wikipedia: Landscape painting↗

    • Landscape painting — part 1 — applied to Genre conventions and composition principles

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

The Dinner Party

The Dinner Party

Jules-Alexandre Grun

La Fleuriste

La Fleuriste

Le Pho

Family on Vacation

Family on Vacation

Roman Selsky

Old wooden cottage in the snow

Old wooden cottage in the snow

Alfred Freddy Krupa

Paris Street

Paris Street

Maurice Utrillo

Grand bouquet of mimosa

Grand bouquet of mimosa

Moise Kisling

Versailles

Versailles

Alexandre Benois

Autumn Landscape with Birches

Autumn Landscape with Birches

Konstantin Gorbatov