plate no. 2126

Japanese Bay

David Burliuk, 1921

oilPost-Impressionismlandscapeseaskycliffsvegetationrockslandscape

recreation guide

David Burliuk’s 'Japanese Bay' (1921) is a Post-Impressionist landscape that likely reflects the artist’s engagement with modernist color theory and traditional oil painting techniques adapted for expressive effect. While specific visual details of this particular canvas are not described in the provided sources, Burliuk’s work is situated within a broader tradition where landscape painting served as a primary source of stylistic innovation (Source 3). The artwork likely employs a methodical approach to color, potentially utilizing glazing and scumbling to achieve depth and luminosity, techniques historically associated with old masters but adapted by modern painters for their own expressive ends (Source 1). The composition would adhere to principles of simultaneous contrast, where colors interact to create vibrancy and tonal gradation rather than relying on flat, isolated hues (Source 2, Source 6).

estimated time

20-30 hours over 5-7 sessions, allowing for drying times between glaze layers

materials

5 items

steps

7 in sequence

materials

item	purpose	modern equivalent
Oil paints (Ultramarine, White, Black, Yellow Ochre, Red Ochre/Venetian Red)	Primary palette for grisaille underpainting and subsequent glazing	—
Oil of Copavia or Linseed Oil	Medium for the first and second paintings, as recommended by Reynolds for glazing	Stand oil or refined linseed oil
Varnish	Mixed with oil for later glazing stages to increase transparency and flow	Dammar varnish or modern painting medium
Canvas or Panel	Support for the oil painting	Linen canvas primed with gesso
Soft Charcoal or Graphite	Initial underdrawing to establish composition	—

preparation

surface prep

The surface should be prepared with a neutral ground, likely white or light grey, to facilitate the glazing process. While Burliuk’s specific preparation for this piece is not detailed, the technique of glazing requires a dry, non-absorbent surface to allow transparent layers to sit atop the underpainting without muddying (Source 1).

underdrawing

A light underdrawing should be made to establish the major compositional elements of the bay, sky, and landforms. Contour drawing principles suggest focusing on the mass and volume of the landscape elements rather than fine detail, using lines to define the spatial relationships between the water, sky, and shore (Source 8).

underpainting

The underpainting should be executed as a grisaille (monochrome) using black, ultramarine, and white, mixed with oil of copavia or a similar medium (Source 1). This step involves mentally extracting red and yellow tones to establish the value structure and form of the landscape. The grisaille must be allowed to dry completely before proceeding to color glazing (Source 1).

color palette

Ultramarine

Pure pigment

Grisaille underpainting and cool shadows in the landscape

White

Lead White or Titanium White

Grisaille highlights and mixing with ultramarine for mid-tones

Black

Ivory Black or Lamp Black

Grisaille shadows and deepening tones

Yellow Ochre

Pure pigment

Glazing to introduce warm earth tones to the land and water reflections

Red Ochre/Venetian Red

Pure pigment

Glazing to introduce warmth and depth to shadows and atmospheric effects

composition

The composition likely emphasizes the wide view characteristic of landscape painting, with the sky playing a significant role in the atmospheric effect (Source 4). Burliuk’s Post-Impressionist style suggests a focus on the interaction of colors and tones rather than strict topographical accuracy. The arrangement of elements would follow principles of simultaneous contrast, where adjacent colors enhance each other’s intensity and tonal value (Source 2, Source 6).

step by step

underdrawing→underpainting→first pass→drying→refining→finishing→varnishing

underdrawing

step 01
Sketch the main compositional elements of the bay, including the horizon line, landmasses, and sky divisions, using soft charcoal.
Tip — Focus on the overall mass and spatial relationships rather than fine details.
Contour drawing

underpainting

step 02
Mix ultramarine, white, and black with oil of copavia to create a grisaille. Paint the entire composition in monochrome, establishing light and shadow values.
Tip — Mentally extract red and yellow tones to focus on value structure.
Grisaille

first pass

step 04
Begin glazing with transparent layers of yellow and red tones mixed with oil. Apply these colors selectively to areas where warmth and depth are needed.
Tip — Apply thin, transparent layers to allow the underlying grisaille to show through.
Glazing

drying

step 03
Allow the grisaille underpainting to dry completely. This may take several days to weeks depending on thickness and environment.
Tip — Do not proceed to glazing until the underpainting is fully dry to prevent muddying.
Drying

refining

step 05
Use scumbling techniques with semi-opaque mixtures to adjust tones and create textural effects, particularly in the sky and water.
Tip — Scumbling over darker grounds can create a grey bloom or coldness, useful for atmospheric effects.
Scumbling

finishing

step 06
Continue to build up layers of glaze and scumble, adjusting for simultaneous contrast effects where adjacent colors interact.
Tip — Observe how adjacent colors influence each other’s perceived tone and hue.
Simultaneous Contrast

varnishing

step 07
Once the painting is completely dry, apply a final varnish to protect the surface and enhance color depth.
Tip — Ensure the painting is fully cured before varnishing to prevent trapping solvents.
Varnishing

critical techniques

Glazing

Applying transparent coats of color over a dry underpainting to achieve depth and luminosity, as practiced by old masters and adapted by modern painters.

Scumbling

Using semi-opaque paint to create textural effects and adjust tones, particularly useful for creating atmospheric grey blooms.

Simultaneous Contrast

Leveraging the interaction of adjacent colors to enhance tonal gradation and color vibrancy, a principle crucial for Post-Impressionist color handling.

common pitfalls

→Applying glazes before the underpainting is fully dry, leading to muddied colors and loss of transparency.
→Ignoring the effects of simultaneous contrast, resulting in flat or dull color interactions.
→Overworking the scumbled layers, which can destroy the delicate balance of semi-transparency.

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

·Specific visual details of 'Japanese Bay' such as the exact layout of the bay, presence of boats or figures, and specific color choices are not described in the sources.
·Burliuk’s specific palette preferences for this period are not detailed, so the palette is inferred from general Post-Impressionist and traditional oil painting practices.
·The exact medium Burliuk used for glazing is not specified, so Reynolds’ recommendation of oil of copavia is suggested as a historical equivalent.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

The Practice of Oil Painting↗
- COLOURING A MONOCHROME — applied to Underpainting and glazing techniques
Laws of Contrast of Colour↗
- 6. Put beside each other two flat tints... — applied to Color interaction and tonal gradation
- 315. As to the advantages... — applied to Color harmony and contrast principles

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

Wikipedia: Landscape painting↗
- Landscape painting — part 7 — applied to Context of Burliuk’s landscape style
- Landscape painting — part 1 — applied to General landscape composition principles
Wikipedia: Contour drawing↗
- Contour drawing — part 1 — applied to Underdrawing approach