apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·HAY-TIME IN TRANSYLVANIA
HAY-TIME IN TRANSYLVANIA by Marianne Stokes

plate no. 4152

HAY-TIME IN TRANSYLVANIA

Marianne Stokes, 1909

oilImpressionismlandscapelandscapetreeshaystacksfiguresskyfield

recreation guide

HAY-TIME IN TRANSYLVANIA (1909) by Marianne Stokes is a landscape painting executed in oil, reflecting the artist’s engagement with Impressionist and naturalist traditions. Stokes, an Austrian-born painter who settled in England and was associated with the Newlyn School, frequently traveled to rural areas such as the Tyrol, Hungary, and the High Tatra to sketch and paint village life and landscapes (Source 6). While her husband Adrian Stokes focused on landscapes and hay-harvesting scenes during their travels, Marianne Stokes is noted for painting portraits with fine detail, though this specific work falls under the landscape genre, likely depicting the natural scenery and weather elements characteristic of the region (Source 1, Source 6). The artwork aligns with the broader Western tradition of landscape painting, which emphasizes coherent composition, sky, and weather as key elements (Source 1).

estimated time

20-30 hours over 5-7 sessions

materials

6 items

steps

6 in sequence

materials

itempurposemodern equivalent
Oil paints (pigment + drying oil)Primary medium for the painting—
Linseed oilGeneral purpose drying oil for mixing paints—
Safflower, walnut, or poppyseed oilFor lighter colors like white to reduce yellowing—
Linen canvasSupport for oil painting, derived from flax—
Palette knife and brushesApplication of paint and mixing—
VarnishFor glazing and finishing, if following traditional methods—

preparation

surface prep

The support is likely linen, a common material for oil painting derived from the flax plant (Source 3, Source 5). The surface should be primed with a ground suitable for oil painting, though specific preparation methods for Stokes are not detailed in the sources. Given her association with the Newlyn School and Impressionist tendencies, a neutral or toned ground may have been used to facilitate the layering of colors.

underdrawing

Sources do not specify Marianne Stokes’ underdrawing techniques. However, given her training under Jules Bastien-Lepage and her naturalist influences, she likely employed a careful preliminary sketch to establish composition, consistent with the detailed observation characteristic of her portrait work (Source 6).

underpainting

While not explicitly stated for Stokes, traditional oil painting techniques often involve an underpainting or grisaille to establish tonal values before applying color (Source 4). This method allows for the extraction of red and yellow tones initially, which are later added through glazing and scumbling (Source 4).

color palette

Earth tones (greens, browns, ochres)

Natural pigments mixed with linseed oil

Depicting the landscape, fields, and foliage

Sky blues and whites

Ultramarine, lead white (historically) or titanium white (modern)

Sky and weather effects, which are almost always included in landscape views (Source 1)

Reds and yellows

Transparent pigments for glazing

Adding warmth and depth through glazing and scumbling techniques (Source 4)

composition

The composition likely features a wide view with elements arranged coherently, including sky and weather as significant components (Source 1). Stokes’ landscapes, influenced by her travels to the High Tatra and Transylvania, would reflect the specific nature of the homeland, a tendency in 19th-century national schools of painting (Source 2). The inclusion of figures or staffage, such as hay-harvesting activities, may be present, as noted in her husband’s work and the general practice of the period (Source 6, Source 8).

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

  1. step 01

    Sketch the composition lightly, focusing on the arrangement of landscape elements, sky, and any figures.

    Tip — Ensure the sky and weather are integrated into the composition from the start.

    Preliminary sketch

underpainting

  1. step 02

    Apply a monochrome underpainting (grisaille) to establish tonal values, excluding red and yellow tones.

    Tip — This allows for better control of light and shadow before adding color.

    Grisaille

first pass

  1. step 03

    Begin applying color, starting with broader strokes for the landscape and sky.

    Tip — Use linseed oil for general mixing, and consider safflower oil for lighter colors to prevent yellowing.

    Direct painting

refining

  1. step 04

    Add details and refine the composition, paying attention to the contrast and harmony of colors.

    Tip — Glaze transparent colors over the dry underpainting to add depth and warmth.

    Glazing and scumbling

finishing

  1. step 05

    Complete the painting with final touches, ensuring the weather and sky elements are cohesive with the landscape.

    Tip — Check for simultaneous contrast effects to enhance color harmony.

    Final adjustments

varnishing

  1. step 06

    Apply a varnish to protect the painting and enhance the colors, if following traditional methods.

    Tip — Ensure the painting is completely dry before varnishing.

    Varnishing

critical techniques

Glazing

Applying transparent coats of color over a dry underpainting to add depth and warmth, a method used by old masters and referenced in traditional oil painting practices.

Scumbling

Using semi-opaque paint over a darker ground to create coldness or grey blooms, enhancing the atmospheric effects in the landscape.

Simultaneous Contrast

Considering the interaction of adjacent colors to enhance tonal gradation and harmony, a principle applicable to landscape painting.

common pitfalls

  • →Overworking the paint, which can muddy the colors and lose the freshness characteristic of Impressionist landscapes.
  • →Ignoring the importance of sky and weather in the composition, which are key elements in landscape painting (Source 1).
  • →Using linseed oil for all colors, which may cause yellowing in lighter tones over time; consider using safflower or poppyseed oil for whites and light colors (Source 3, Source 5).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific details of Marianne Stokes’ palette and pigment choices for this particular painting are not provided in the sources.
  • ·The exact compositional layout of HAY-TIME IN TRANSYLVANIA is not described, so the guide relies on general landscape painting principles and Stokes’ known practices.
  • ·Information on whether Stokes used varnish or specific mediums in her later works is not detailed.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Underpainting and glazing techniques
  • Laws of Contrast of Colour↗

    • 6. Put beside each other two flat tints — applied to Color theory and contrast principles

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Landscape painting↗

    • Landscape painting — part 1 — applied to Composition notes and importance of sky/weather
  • Wikipedia: Oil painting↗

    • Oil painting — part 4 — applied to Materials list and drying oils
  • Wikipedia bio — Marianne Stokes↗

    • Marianne Stokes — part 1 — applied to Artist background and travel influences

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann