apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·First Touch of Autumn
First Touch of Autumn by William Merritt Chase

plate no. 0067

First Touch of Autumn

William Merritt Chase

oil, canvasImpressionismlandscapelandscapefieldpathskytreesvegetation

recreation guide

William Merritt Chase’s *First Touch of Autumn* is a landscape executed in oil on canvas, reflecting the American Impressionist style. While specific visual details of this particular composition are not described in the provided sources, Chase’s general practice involved capturing the transient effects of light and atmosphere, consistent with the Impressionist focus on 'modifications of the light on the model' (Source 2). The work likely employs a sophisticated handling of color contrast and glazing techniques to render the seasonal shift, utilizing the flexibility and rich density of oil paint to layer transparent and semi-opaque tones (Source 5). The composition adheres to the tradition of landscape painting, which arranges natural scenery into a coherent view, often including sky and weather elements to convey a specific atmospheric condition (Source 3).

estimated time

20-30 hours over 5-7 sessions, allowing for drying times between glaze layers

materials

5 items

steps

6 in sequence

materials

itempurposemodern equivalent
Oil paints (Yellow Ochre, Red Ochre, White Lead/Titanium White, Ultramarine, Black)Primary pigments for underpainting and color mixing. Ochres and earths are noted for their covering power and ease of drying (Source 7).Titanium White is the modern standard for white; Yellow and Red Ochre remain standard earth pigments.
Linseed Oil or Poppy Seed OilBinder for the paint. Linseed oil provides richness and density, while poppy seed oil yellows less (Source 5).Refined Linseed Oil or Stand Oil.
Turpentine or Odorless Mineral SpiritsThinner for initial washes and cleaning brushes (Source 5).Odorless Mineral Spirits (OMS).
Varnish (e.g., Dammar or Copal)Used in later stages for glazing and scumbling to gain mastery over transparent layers (Source 1).Artist-grade picture varnish.
CanvasSupport for the oil painting (Source 5).Linen or cotton canvas, primed.

preparation

surface prep

The canvas should be primed with a ground suitable for oil painting. While specific priming recipes for Chase are not detailed in the sources, the tradition of oil painting on canvas involves preparing a surface that allows for the 'greater flexibility, richer and denser color' of the medium (Source 5). A neutral or warm-toned ground may be beneficial to facilitate the glazing techniques described.

underdrawing

Chase’s preparatory methods are not explicitly detailed in the provided sources. However, Impressionist landscapes often rely on loose, rapid sketching to capture the 'prompt and sure' imitation of light modifications (Source 2). It is likely that any underdrawing was minimal or executed in thinned paint to avoid interfering with the subsequent color layers.

underpainting

A grisaille (monochrome underpainting) is recommended, following the method described in Source 1. This involves establishing the tonal values without red and yellow colors, mentally extracting them to translate what would be left in nature. This layer must be completely dry before proceeding to glazing (Source 1).

color palette

Yellow Ochre

Pure pigment

General use in earth tones and autumn foliage. Earths are noted for their 'perfect fixedness' and covering qualities (Source 7).

Red Ochre

Pure pigment

General use in autumn tones. Used in conjunction with yellow ochre in the glazing stage (Source 1).

White (Lead or Titanium)

Pure pigment

Lightening tones and highlights. Note that adding white can shift hue towards blue in reds/oranges, requiring correction with adjacent colors (Source 4).

Ultramarine

Pure pigment

Shadows and cool tones. Cited in Reynolds’ method for initial paintings (Source 1).

Black (Ivory or Lamp)

Pure pigment

Darkening tones. However, adding black can shift hues towards green/blue; using complements is preferred for neutralizing without hue shift (Source 4).

composition

The composition likely follows the conventions of landscape painting, depicting natural scenery such as trees and sky arranged into a coherent view (Source 3). The sky is almost always included, and weather conditions are often an element of the composition (Source 3). Chase’s Impressionist style suggests a focus on the 'modifications of tone and of colour which they receive from contiguous colours' (Source 2), implying a composition where color relationships are as important as linear structure.

step by step

underpainting→first pass→refining→finishing→varnishing

underpainting

  1. step 01

    Create a grisaille underpainting using black, ultramarine, and white. Mentally extract red and yellow colors to establish the tonal structure of the landscape.

    Tip — Ensure this layer is completely dry before proceeding. This step translates the scene as if red and yellow were not present (Source 1).

    Grisaille

first pass

  1. step 02

    Apply glazes of yellow and red tones over the dry grisaille. Use oil as a medium initially.

    Tip — Glazing is a transparent coat of color. Apply it much like tinting an engraving with watercolors (Source 1).

    Glazing

refining

  1. step 03

    Use scumbling to add semi-opaque layers, particularly over darker grounds to create coldness or grey blooms.

    Tip — Scumbling allows the underlying painting to show through. It is useful for creating atmospheric effects and grey tones (Source 1).

    Scumbling

  2. step 04

    Adjust color contrasts by considering simultaneous contrast. Ensure that adjacent colors do not inadvertently shift the perceived hue of neighboring areas.

    Tip — The eye perceives colors differently when viewed together. The lightest tone will be lowered and the darkest heightened by adjacent colors (Source 2).

    Simultaneous Contrast

finishing

  1. step 05

    Correct any hue shifts caused by adding white or black. If lightening reds/oranges causes a blue shift, add a small amount of an adjacent color (e.g., orange) to correct it.

    Tip — Adding white to reds/oranges can shift them towards blue. Adding black can shift yellows/oranges towards green/blue. Use complements or adjacent colors to neutralize (Source 4).

    Hue Correction

varnishing

  1. step 06

    Apply a final varnish if desired, potentially mixed with oil for further glazing mastery.

    Tip — Varnish can be mixed with oil for glazing once sufficient mastery is gained (Source 1).

    Varnishing

critical techniques

Glazing and Scumbling

Glazing involves applying transparent coats of color, while scumbling uses semi-opaque paint to allow the underlayer to show through. These techniques were practiced by old masters and are useful for creating complex tones and atmospheric effects (Source 1).

Simultaneous Contrast

Understanding that colors appear different when placed next to each other. The painter must appreciate the color peculiar to each part and the modifications received from contiguous colors (Source 2).

Color Mixing with Complements

Using complementary colors to darken or neutralize tones without shifting the hue, rather than adding black or white which can cause unwanted hue shifts (Source 4).

common pitfalls

  • →Adding black to darken colors can cause yellows, oranges, and reds to shift towards green or blue (Source 4).
  • →Adding white to lightens colors can cause reds and oranges to shift towards blue (Source 4).
  • →Neglecting simultaneous contrast can lead to inaccurate color perception, as adjacent colors modify the appearance of each other (Source 2).
  • →Applying glazes before the underpainting is completely dry can ruin the monochrome foundation (Source 1).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific visual details of *First Touch of Autumn* (e.g., exact tree placement, sky conditions) are not described in the sources.
  • ·Chase’s specific brushwork style (e.g., impasto vs. smooth) is not detailed in the provided passages, though Impressionism generally favors visible brushstrokes.
  • ·The exact palette Chase used for this specific painting is not listed; the palette provided is based on general oil painting practices and the sources' recommendations.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Underpainting (grisaille), glazing, and scumbling techniques.
  • Laws of Contrast of Colour↗

    • 315-318 — applied to Understanding simultaneous contrast and color modifications.
  • The Science of Painting↗

    • CHAPTER V. COLOURING SUBSTANCES — applied to Use of earth pigments like ochres.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Landscape painting↗

    • part 1 — applied to General composition and inclusion of sky/weather.
  • Wikipedia: Color theory↗

    • part 6 — applied to Color mixing pitfalls and hue correction.
  • Wikipedia: Oil painting↗

    • part 1 — applied to Materials and properties of oil paint.

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann