apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Le Havre. Heavy Winds off of Frascati.
Le Havre. Heavy Winds off of Frascati. by Eugene Boudin

plate no. 9563

Le Havre. Heavy Winds off of Frascati.

Eugene Boudin, 1896

oilImpressionismlandscapeseawavesskylighthousecloudsbeach

recreation guide

Eugène Boudin’s 'Le Havre. Heavy Winds off of Frascati' (1896) is a late-career oil landscape that exemplifies his reputation as the 'King of the skies' and a pioneer of painting outdoors (en plein air) (Source 4). As one of the first French landscape painters to work directly from nature, Boudin’s practice was deeply influenced by Dutch 17th-century masters and his mentor Johan Jongkind, who advised him to capture the transient effects of light and weather (Source 4). The artwork likely emphasizes the atmospheric conditions—specifically the heavy winds and sky—consistent with Boudin’s expertise in rendering marine and coastal scenes where the sky and weather are central compositional elements (Source 3, Source 4). While the title references Frascati (an Italian location), Boudin’s late work often retained the summary, economic brushwork and focus on atmospheric truth characteristic of his earlier Normandy and Brittany studies (Source 4).

estimated time

20-30 hours over 5-7 sessions

materials

4 items

steps

4 in sequence

materials

itempurposemodern equivalent
Oil paints (Ultramarine, White, Black, Yellow Ochre, Red Ochre)Primary pigments for establishing tone and color. Ultramarine and white are noted in historical methods for initial layers (Source 2).—
Oil of Copavia or Linseed OilMedium for thinning paints during the first and second painting stages to allow for transparency and flow (Source 2).Stand oil or refined linseed oil
Canvas or PanelSupport for the oil painting.—
VarnishUsed in later stages for glazing and scumbling to achieve atmospheric effects and color depth (Source 2).Dammar varnish or synthetic resin varnish

preparation

surface prep

While specific preparation for this 1896 work is not detailed in the sources, Boudin’s practice as an en plein air painter suggests a need for a portable, primed surface. Historically, artists of this period often used a neutral or toned ground to facilitate the perception of light and shadow. The sources note that Boudin was influenced by Dutch masters, who often employed careful ground preparations, but Boudin’s 'summary and economic' style implies a direct approach to the surface (Source 4).

underdrawing

Boudin’s preparatory methods are not explicitly detailed in the provided sources. However, as a painter who worked 'promptly and surely' to imitate light modifications (Source 1), he likely used a loose, rapid underdrawing or directly blocked in shapes with paint. The sources do not describe specific sketching techniques for this artwork, so the underdrawing should be minimal and flexible, allowing for changes as the atmospheric conditions shift.

underpainting

The sources suggest a method involving a monochrome or limited palette underpainting. Source 2 describes a technique where the first and second paintings are done with oil of copavia using black, ultramarine, and white. This grisaille-like stage allows the artist to establish tone and composition before applying color glazes. Boudin’s focus on the sky and light modifications supports the use of a tonal underpainting to capture the 'modifications of the light on the model' (Source 1).

color palette

Ultramarine

Pure Ultramarine

Establishing the sky and deep shadows in the initial tonal layers (Source 2).

White

Lead White or Zinc White

Highlighting clouds and light reflections; mixed with ultramarine for sky tones (Source 2).

Black

Ivory Black or Lamp Black

Deepening shadows and defining forms in the initial monochrome stage (Source 2).

Yellow/Red Tones

Yellow Ochre, Red Ochre, or Cadmium Yellow/Red

Applied later via glazing and scumbling to introduce warmth and atmospheric color, particularly in the sky and sea reflections (Source 2).

composition

Boudin characteristically placed significant emphasis on the sky, often referred to as the 'King of the skies' (Source 4). In landscape painting, the sky is almost always included and weather is often an element of the composition (Source 3). For this artwork, the composition likely features a dominant sky area to convey the 'heavy winds' mentioned in the title. The arrangement of elements should be coherent, with the sky and sea interacting to reflect the atmospheric conditions. Specific details of the harbor or buildings are not described in the sources, so the focus should remain on the broad masses of light and color rather than topographical precision (Source 3).

step by step

underpainting→first pass→refining→finishing

underpainting

  1. step 01

    Apply a thin layer of paint using black, ultramarine, and white mixed with oil of copavia (or a similar medium) to establish the tonal values of the sky and sea. Focus on the broad masses of light and shadow.

    Tip — Ensure the layer is dry before proceeding. This stage is about capturing the 'modifications of the light' rather than color (Source 1, Source 2).

    Monochrome underpainting

first pass

  1. step 02

    Once the underpainting is dry, begin applying color glazes. Use transparent coats of yellow and red tones to introduce warmth and atmospheric depth, particularly in the sky and highlights.

    Tip — Glazing involves applying a transparent coat of color over the dry underpainting. This allows the underlying tones to show through, creating luminosity (Source 2).

    Glazing

refining

  1. step 03

    Use scumbling to add semi-opaque layers of color, particularly for the clouds and wind effects. Scumbling involves dragging a semi-opaque paint over the surface to create a textured, atmospheric effect.

    Tip — Scumbling over a darker ground can create a 'grey bloom' or coldness, which may be useful for depicting heavy winds and overcast skies (Source 2).

    Scumbling

finishing

  1. step 04

    Refine the edges and adjust the color contrasts. Pay attention to the simultaneous contrast of colors, ensuring that adjacent colors enhance each other’s intensity and tone.

    Tip — Be aware that the eye may perceive colors inaccurately due to mixed contrast. Adjust tones to ensure the lightest tones are not lowered and darkest tones are not heightened unintentionally (Source 1).

    Simultaneous Contrast

critical techniques

Glazing and Scumbling

Used to build up color and atmospheric effects. Glazing adds transparent color layers, while scumbling adds semi-opaque texture. This method was practiced by old masters and is useful for achieving the 'grey bloom' or atmospheric haze typical of Boudin’s skies (Source 2).

Simultaneous Contrast

Understanding how adjacent colors affect each other’s perception. This helps in accurately rendering the modifications of light and color in the landscape, ensuring that the sky and sea interact correctly (Source 1).

En Plein Air Painting

Painting outdoors to capture the immediate effects of light and weather. Boudin was advised by Jongkind to paint outdoors, which influenced his summary and economic style (Source 4).

common pitfalls

  • →Over-modeling or being too tied to outlines, which can detract from the atmospheric quality. Boudin’s style was 'summary and economic,' so avoid excessive detail (Source 4).
  • →Ignoring the effects of simultaneous contrast, leading to inaccurate color perception. The eye may see colors differently due to adjacent hues, so adjust tones accordingly (Source 1).
  • →Applying glazes before the underpainting is fully dry, which can muddy the colors and ruin the transparency effect (Source 2).
  • →Focusing too much on topographical accuracy rather than the atmospheric and light effects, which are central to Boudin’s landscape practice (Source 3, Source 4).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific details of the composition, such as the exact placement of buildings or figures, are not described in the sources.
  • ·The specific pigments used by Boudin in 1896 are not detailed, though historical conventions suggest ultramarine, white, and black for underpainting.
  • ·The exact ratio of oil to varnish for glazing is not specified, requiring experimentation based on general oil painting practices.
  • ·Boudin’s specific brushwork techniques for depicting 'heavy winds' are not described, so the artist must infer this from his general style and the title.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Underpainting, glazing, and scumbling techniques
  • Laws of Contrast of Colour↗

    • 315-318 — applied to Color perception and simultaneous contrast

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia bio — Eugene Boudin↗

    • part 1 — applied to Artist’s background, en plein air practice, and influence of Jongkind
  • Wikipedia: Landscape painting↗

    • part 1 — applied to Role of sky and weather in landscape composition

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann