apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Jardin a Sint-Martens-Latem
Jardin a Sint-Martens-Latem by Gustave de Smet

plate no. 3683

Jardin a Sint-Martens-Latem

Gustave de Smet, 1910

oilImpressionismlandscapelandscapetreesfieldskysunladder

recreation guide

Gustave de Smet’s 'Jardin a Sint-Martens-Latem' (1910) represents a pivotal moment in the artist’s career, situated within the Latem School’s tradition of painting en plein air in the rural Lys river area (Source 5). While the artwork is classified under Impressionism in the prompt, De Smet’s practice during this period was characterized by a move away from bourgeois art toward a more direct, innovative engagement with nature, often drawing inspiration from the lives of workers and farmers (Source 5). The painting likely exhibits the artist’s early exploration of color harmony and contrast, principles he would later refine under the influence of the Bergen School and German Expressionism (Source 4). As a landscape, it focuses on natural scenery, potentially including trees, gardens, or wide views, with the sky and weather serving as integral compositional elements (Source 3).

estimated time

20-30 hours over 5-7 sessions

materials

5 items

steps

5 in sequence

materials

itempurposemodern equivalent
Oil paints (pigment + drying oil)Primary medium for the paintingStandard tube oil paints
Linseed oilDrying oil for mixing paint; general purpose mediumRefined linseed oil
Canvas or linen supportSurface for painting; linen is historically consistent with oil painting traditionsPrimed linen canvas
Brushes (various sizes)Application of paint; De Smet later used broad brushstrokes, suggesting robust brushesHog bristle brushes for oil
Palette knifeMixing colors and potentially applying thick paint (impasto)Standard palette knife

preparation

surface prep

The surface should be prepared with a ground suitable for oil painting. While specific preparation methods for this 1910 work are not detailed in the sources, De Smet’s later practice involved applying paint in 'solid masses' (Source 4), suggesting a sturdy, well-primed surface capable of supporting heavy paint application. A traditional oil ground or acrylic gesso would be appropriate.

underdrawing

De Smet preferred to work in nature without a teacher and aimed to innovate by turning away from bourgeois art (Source 5). While specific underdrawing techniques for this piece are not recorded, contour drawing principles suggest emphasizing mass and volume rather than minor details (Source 8). The artist likely sketched the basic forms of the garden elements directly on the canvas or with a light underpainting to establish composition.

underpainting

An underpainting may have been used to establish tone and color relationships. De Smet’s later work emphasized chiaroscuro effects (Source 4), implying an early interest in light and shadow. A grisaille or tonal underpainting could help in harmonizing the colors inherent to the landscape (Source 2).

color palette

Greens and Earth Tones

Viridian, Yellow Ochre, Raw Umber, White

General use in landscape painting; De Smet’s later palette shifted to warm autumnal tones, but 1910 works likely reflect natural garden colors

Blues and Whites

Ultramarine, Cerulean, Lead White (historically) or Titanium White

Sky and light reflections; De Smet’s work often included sky as an important part of the composition (Source 3)

Complementary Colors

Reds, Oranges, Purples

Creating contrast and harmony; De Smet’s practice involved understanding simultaneous contrast of colors (Source 1)

composition

The composition likely arranges natural elements such as trees, garden paths, or buildings into a coherent view (Source 3). De Smet’s later work emphasized a 'well-organized and balanced structure' (Source 4), suggesting that even in 1910, he sought balance in his landscapes. The sky is almost always included in landscape views, and weather effects may be present (Source 3). Specific compositional moves are not detailed in the sources, so the artist should focus on creating a harmonious arrangement of natural forms.

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

  1. step 01

    Sketch the basic forms of the garden elements, focusing on mass and volume rather than detail.

    Tip — Emphasize the outlined shape of the subject; avoid minor details (Source 8).

    Contour drawing

underpainting

  1. step 02

    Apply a thin layer of paint to establish tone and color relationships, particularly light and shadow.

    Tip — Consider the law of simultaneous contrast to harmonize colors (Source 1).

    Grisaille or tonal underpainting

first pass

  1. step 03

    Block in the main colors of the landscape, paying attention to the inherent colors of the objects (Source 2).

    Tip — Use colors that are inherent to the model, such as the green of leaves and the blue of the sky (Source 2).

    Direct painting

refining

  1. step 04

    Refine the colors and tones, considering the effects of simultaneous contrast between adjacent colors.

    Tip — Adjust colors based on their interaction with neighboring hues; the lightest tone will be lowered, and the darkest heightened (Source 1).

    Simultaneous contrast

finishing

  1. step 05

    Add final details and adjustments, ensuring the composition is balanced and harmonious.

    Tip — De Smet’s later work used broad brushstrokes and solid masses of paint; consider this approach for texture (Source 4).

    Glazing or scumbling

critical techniques

Simultaneous Contrast of Colors

Understanding how adjacent colors affect each other’s appearance; essential for harmonizing the composition (Source 1).

Chiaroscuro

De Smet’s later work emphasized chiaroscuro effects; this technique involves using light and shadow to create volume and depth (Source 4).

Broad Brushstrokes

De Smet’s mature style involved applying paint in broad brushstrokes, leading to solid masses of paint (Source 4).

common pitfalls

  • →Ignoring the effects of simultaneous contrast, leading to disharmonious color relationships (Source 1).
  • →Over-detailing the landscape, which contradicts the Impressionist and early Expressionist focus on mass and volume (Source 8).
  • →Using a palette that does not reflect the inherent colors of the natural scene, failing to harmonize with the model (Source 2).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific color palette used in 'Jardin a Sint-Martens-Latem' is not detailed in the sources.
  • ·Exact compositional layout of the garden elements is not described.
  • ·De Smet’s specific underdrawing or underpainting techniques for this 1910 work are not recorded.
  • ·The extent to which De Smet had already adopted Expressionist techniques in 1910 is unclear, as his major shift occurred after 1914 (Source 4).

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • Laws of Contrast of Colour↗

    • Simultaneous Contrast of Colours — applied to Color harmony and contrast principles

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia bio — Gustave de Smet↗

    • Biography — applied to Artist’s background, style evolution, and techniques
  • Wikipedia: Landscape painting↗

    • Landscape painting — applied to Genre conventions and compositional elements
  • Wikipedia: Contour drawing↗

    • Contour drawing — applied to Underdrawing technique

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann