plate no. 3683

Jardin a Sint-Martens-Latem

Gustave de Smet, 1910

oilImpressionismlandscapelandscapetreesfieldskysunladder

what to study here

It shows how a painting can build depth and light from temperature shifts and a few value masses, without strong contrast or hard edges.

Look at how this painting holds together with very little value contrast. Squinting gives three masses: a bright yellow sky, a darker band of horizon trees, and a lighter foreground of fields. Everything sits in the mid-to-light range and the warm light unifies it. The one dark accent is the vertical poplar on the right, with a ladder against it. It is the only strong upright, and it draws the eye down from the sun in the upper left-center. Study the color temperature shift in the fields: warm yellows near the horizon, cooler greens toward the bottom. That shift, along with horizontal strokes, carries the depth. Note the edges. Almost everything is soft, and the trunk against the sky is the main place where an edge turns solid. The brushwork is visible and directional, with an almost spiral quality in the sky around the sun, and the paint is not blended smooth. Colors sit beside each other instead of being merged. Copy the way the horizon band stays distinct from the sky by value while its edge stays soft.

key decision

The painter kept the whole scene in a narrow mid-to-light value range and used the warm-to-cool shift in the fields, plus a soft but darker horizon band, to create space. The single dark vertical trunk anchors the composition.

recreation guide

Gustave de Smet’s 'Jardin a Sint-Martens-Latem' (1910) represents a pivotal moment in the artist’s career, situated within the Latem School’s tradition of painting en plein air in the rural Lys river area (Source 5). While the artwork is classified under Impressionism in the prompt, De Smet’s practice during this period was characterized by a move away from bourgeois art toward a more direct, innovative engagement with nature, often drawing inspiration from the lives of workers and farmers (Source 5). The painting likely exhibits the artist’s early exploration of color harmony and contrast, principles he would later refine under the influence of the Bergen School and German Expressionism (Source 4). As a landscape, it focuses on natural scenery, potentially including trees, gardens, or wide views, with the sky and weather serving as integral compositional elements (Source 3).

estimated time

20-30 hours over 5-7 sessions

materials

5 items

steps

5 in sequence

materials

item	purpose	modern equivalent
Oil paints (pigment + drying oil)	Primary medium for the painting	Standard tube oil paints
Linseed oil	Drying oil for mixing paint; general purpose medium	Refined linseed oil
Canvas or linen support	Surface for painting; linen is historically consistent with oil painting traditions	Primed linen canvas
Brushes (various sizes)	Application of paint; De Smet later used broad brushstrokes, suggesting robust brushes	Hog bristle brushes for oil
Palette knife	Mixing colors and potentially applying thick paint (impasto)	Standard palette knife

preparation

surface prep

The surface should be prepared with a ground suitable for oil painting. While specific preparation methods for this 1910 work are not detailed in the sources, De Smet’s later practice involved applying paint in 'solid masses' (Source 4), suggesting a sturdy, well-primed surface capable of supporting heavy paint application. A traditional oil ground or acrylic gesso would be appropriate.

underdrawing

De Smet preferred to work in nature without a teacher and aimed to innovate by turning away from bourgeois art (Source 5). While specific underdrawing techniques for this piece are not recorded, contour drawing principles suggest emphasizing mass and volume rather than minor details (Source 8). The artist likely sketched the basic forms of the garden elements directly on the canvas or with a light underpainting to establish composition.

underpainting

An underpainting may have been used to establish tone and color relationships. De Smet’s later work emphasized chiaroscuro effects (Source 4), implying an early interest in light and shadow. A grisaille or tonal underpainting could help in harmonizing the colors inherent to the landscape (Source 2).

color palette

Greens and Earth Tones

Viridian, Yellow Ochre, Raw Umber, White

General use in landscape painting; De Smet’s later palette shifted to warm autumnal tones, but 1910 works likely reflect natural garden colors

Blues and Whites

Ultramarine, Cerulean, Lead White (historically) or Titanium White

Sky and light reflections; De Smet’s work often included sky as an important part of the composition (Source 3)

Complementary Colors

Reds, Oranges, Purples

Creating contrast and harmony; De Smet’s practice involved understanding simultaneous contrast of colors (Source 1)

composition

The composition likely arranges natural elements such as trees, garden paths, or buildings into a coherent view (Source 3). De Smet’s later work emphasized a 'well-organized and balanced structure' (Source 4), suggesting that even in 1910, he sought balance in his landscapes. The sky is almost always included in landscape views, and weather effects may be present (Source 3). Specific compositional moves are not detailed in the sources, so the artist should focus on creating a harmonious arrangement of natural forms.

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

step 01
Sketch the basic forms of the garden elements, focusing on mass and volume rather than detail.
Tip — Emphasize the outlined shape of the subject; avoid minor details (Source 8).
Contour drawing

underpainting

step 02
Apply a thin layer of paint to establish tone and color relationships, particularly light and shadow.
Tip — Consider the law of simultaneous contrast to harmonize colors (Source 1).
Grisaille or tonal underpainting

first pass

step 03
Block in the main colors of the landscape, paying attention to the inherent colors of the objects (Source 2).
Tip — Use colors that are inherent to the model, such as the green of leaves and the blue of the sky (Source 2).
Direct painting

refining

step 04
Refine the colors and tones, considering the effects of simultaneous contrast between adjacent colors.
Tip — Adjust colors based on their interaction with neighboring hues; the lightest tone will be lowered, and the darkest heightened (Source 1).
Simultaneous contrast

finishing

step 05
Add final details and adjustments, ensuring the composition is balanced and harmonious.
Tip — De Smet’s later work used broad brushstrokes and solid masses of paint; consider this approach for texture (Source 4).
Glazing or scumbling

critical techniques

Simultaneous Contrast of Colors

Understanding how adjacent colors affect each other’s appearance; essential for harmonizing the composition (Source 1).

Chiaroscuro

De Smet’s later work emphasized chiaroscuro effects; this technique involves using light and shadow to create volume and depth (Source 4).

Broad Brushstrokes

De Smet’s mature style involved applying paint in broad brushstrokes, leading to solid masses of paint (Source 4).

common pitfalls

→Ignoring the effects of simultaneous contrast, leading to disharmonious color relationships (Source 1).
→Over-detailing the landscape, which contradicts the Impressionist and early Expressionist focus on mass and volume (Source 8).
→Using a palette that does not reflect the inherent colors of the natural scene, failing to harmonize with the model (Source 2).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

·Specific color palette used in 'Jardin a Sint-Martens-Latem' is not detailed in the sources.
·Exact compositional layout of the garden elements is not described.
·De Smet’s specific underdrawing or underpainting techniques for this 1910 work are not recorded.
·The extent to which De Smet had already adopted Expressionist techniques in 1910 is unclear, as his major shift occurred after 1914 (Source 4).

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

Laws of Contrast of Colour↗
- Simultaneous Contrast of Colours — applied to Color harmony and contrast principles

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

Wikipedia bio — Gustave de Smet↗
- Biography — applied to Artist’s background, style evolution, and techniques
Wikipedia: Landscape painting↗
- Landscape painting — applied to Genre conventions and compositional elements
Wikipedia: Contour drawing↗
- Contour drawing — applied to Underdrawing technique

Read more about the corpus on the sources page and how the guides are built on the methods page.

read from the painting

observed from the image, not the label

6 dominant colors, measured

what the eye sees

The light source is a bright sun positioned in the upper left-center area, casting warm golden light across the entire scene. The composition divides cleanly into horizontal bands: an intense yellow sky above, a softer horizon line of trees establishing the mid-tone anchor, and foreground fields that shift from warm yellows near the horizon to cooler greens at the bottom. The vertical poplar tree on the right side, marked by a visible ladder, provides the only strong upright element and draws the eye downward from the sun. The overall effect is luminous and unified by the warm light.

value structure

The lightest values (brightest yellows) cluster around the sun and upper sky, gradually softening as they move toward the horizon. The horizon trees establish a clear mid-to-dark value band that separates sky from fields. The foreground sits in a relatively light value range despite the greens, with the tree trunk providing the only notably dark accent. There is no extreme contrast—everything reads as mid-to-light values unified by warm light. Squinting reveals three distinct value masses: bright sky, darker horizon band, and lighter foreground.

observed palette and mixes

#e3da76
Cadmium yellow + titanium white
The brightest sky directly surrounding the sun in the upper left-center area
#e0db9f
Cadmium yellow + titanium white + yellow ochre
Warm golden sky surrounding the bright sun area, extending toward the top
#d6cc87
Yellow ochre + cadmium yellow + titanium white
Mid-tone golden yellows throughout the sky and upper foreground
#c9c088
Sap green + yellow ochre + raw umber + titanium white
The horizon line of trees and middle-ground landscape, softer and more atmospheric than the sky
#c1b589
Yellow ochre + raw umber + titanium white
Warm shadows and mid-tones in the lower foreground, particularly beneath the tree
#a6ac77
Sap green + yellow ochre with a touch of light blue to cool and mute
The green foreground fields showing atmospheric perspective; cooler than the upper foreground

edges and brushwork

The brushwork is visible and directional throughout, with loose, expressive strokes following the forms and light direction. The sky shows energetic marks with an almost spiral quality around the sun. The foreground fields display clear horizontal strokes that reinforce perspective and ground movement. Edges are consistently soft—nothing is hard-edged, except where the tree trunk sits against the sky as a solid vertical form. The paint application reads as fresh and direct, with obvious texture and no attempt to blend smoothly.

a working sequence

01
Toned ground and composition
Lay down a warm mid-tone wash of yellow ochre + white across the entire canvas. While still damp, lightly block in the horizon line with darker value and indicate where the sun will sit (upper left-center), the tree trunk position (right side), and field divisions. This warm foundation pulls everything into harmony and prevents the painting from reading cold or scattered.
02
Sky foundation
Paint the sky with loose, directional brushstrokes in warm yellows. Start brighter near the sun with cadmium yellow + white, shifting to yellow ochre + white as you move outward. Don't overblend—keep brushwork visible and let colors transition naturally. The sky should read as flooded with warm light.
03
The sun
Paint the sun as a concentrated bright spot with cadmium yellow + titanium white in the upper left-center area. Keep edges slightly diffused so it glows into the surrounding sky rather than appearing as a hard circle. This is your brightest focal point.
04
Horizon and trees
Paint the band of trees along the horizon with sap green + yellow ochre + raw umber + white, creating muted, atmospheric color. This should feel noticeably softer and cooler than the sky but warm enough to belong in the scene. Ensure it reads clearly darker than the sky—this value separation is crucial for establishing depth.
05
Foreground fields
Paint the foreground with confident horizontal brushstrokes following field rows. Upper foreground (nearest horizon) stays warm and yellowish; lower foreground shifts to cooler greens with more sap green. These directional strokes and color temperature shifts create atmospheric perspective.
06
Tree trunk and ladder
Paint the vertical poplar on the right with cool gray-green (raw umber + light blue + sap green + white) using confident vertical strokes. Paint the ladder simply with a few clear lines—it should read immediately without detail. The tree's coolness against surrounding warmth is intentional and anchors the composition.
07
Refine and unify
Step back and assess overall light logic. The scene should feel bathed in warm, clear light from the upper left. Check that your horizon line is atmospheric but distinct. Ensure the tree shadow reads as cast by the same sun lighting the sky. Adjust any passages where temperature or value feels out of step.
08
Final touches
Add final clarifications to the ladder, refine the tree trunk edge where it meets the sky, and ensure every passage feels intentional. Stop before overworking—the painted, direct quality is essential. This painting succeeds through decisive marks and color sitting beside each other, not perfectly merged.

where studies of this painting go wrong

The sun can easily become too acidic or harsh if you oversaturate the yellow-white—resist this temptation. It needs to glow warmly within the overall golden harmony, not feel raw or artificial.
The tree trunk as a cool gray-green can feel isolated or wrong if you doubt the color—place it with confidence and ensure its value reads clearly distinct from the sky. Timidity will make it lose its anchor function.
Field divisions will flatten into undifferentiated wash if each band is painted uniformly. Every passage needs subtle internal color and value shifts; greens must cool as they recede, yellows must shift in temperature. This is where perspective lives.
Overworking with blending and smoothing will destroy the painted, luminous quality. This painting succeeds through decisive brushstrokes and colors sitting beside each other rather than perfectly merged.
The horizon line can disappear without careful edge management—make it soft but maintain clear value separation between sky and trees. Without this edge, spatial structure collapses.

measured difficulty