apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Haystacks
Haystacks by Gustave de Smet

plate no. 7038

Haystacks

Gustave de Smet, 1914

oilImpressionismlandscapehaystacksfieldskycloudslandscapehouse

recreation guide

Gustave de Smet’s 1914 oil painting *Haystacks* represents a pivotal moment in his artistic development, occurring during his exile in the Netherlands at the outbreak of World War I. While the artwork is categorized under Impressionism in the prompt, historical records indicate that during this period (1914–1922), de Smet was transitioning away from pure visual imitation toward a style influenced by the Bergen School and German Expressionism (Source 5). This shift is characterized by a move toward 'pure expression' rather than strict realism, utilizing simplified lines, shapes, and chiaroscuro effects to convey personal feeling (Source 5). The work likely exhibits a 'well-organized and balanced structure' that augments its expressive quality, moving beyond the Latem School’s earlier naturalism (Source 6).

estimated time

20-30 hours over 5-7 sessions

materials

4 items

steps

5 in sequence

materials

itempurposemodern equivalent
Oil paints (warm autumnal tones, blacks, ultramarine, white)Primary medium for creating the saturated palette and solid masses of paint characteristic of de Smet's post-1914 style.—
Canvas or linen supportStandard support for oil painting.—
Oil of copavia or similar resinous mediumHistorical medium used by artists of this tradition for glazing and binding pigments, as noted in Reynolds' method which influenced the period's technical discourse.Liquin or Galkyd
Brushes (various sizes for broad brushstrokes)To apply paint in 'broad brushstrokes leading to solid masses,' a key feature of de Smet's evolving style.—

preparation

surface prep

Prepare a standard oil ground. While de Smet’s specific ground preparation for this exact work is not detailed, the general practice of the period and the 'old masters' referenced in technical texts involved preparing a surface capable of supporting glazing and scumbling techniques (Source 4). Given the shift toward 'solid masses of paint' in his later work, a robust, absorbent ground would be appropriate to handle the impasto.

underdrawing

De Smet’s work during this period emphasized 'simplified lines and shapes' (Source 5). A loose, gestural underdrawing focusing on the mass and volume of the haystacks and landscape elements, rather than fine detail, is consistent with the contour drawing principles that emphasize form over minor details (Source 8). The drawing should establish the 'well-organized and balanced structure' noted in his biography (Source 5).

underpainting

Consider a grisaille or monochrome underpainting. Technical texts from the era describe a method where a monochrome base is established, from which red and yellow tones are mentally extracted, before glazing and scumbling color over it (Source 4). This technique allows for the 'chiaroscuro effects' de Smet began to employ (Source 5). Alternatively, given his move toward 'solid masses of paint,' a direct alla prima approach with thick application may be more appropriate for the final layers, but an underpainting helps manage the 'modifications of the light' (Source 3).

color palette

Warm Autumnal Tones

Ochres, Umbers, Siennas, mixed with White

De Smet’s palette changed to 'warm autumnal tones' during his exile in the Netherlands (Source 5). These would be used for the haystacks and earthy landscape elements.

Black

Ivory Black or Lamp Black

Applied in 'broad brushstrokes leading to solid masses of paint' to create depth and structure (Source 5).

Ultramarine

Ultramarine Blue

Part of the traditional palette mentioned in historical technical contexts (Source 4), likely used for sky or shadow contrasts.

White

Lead White or Zinc White

Used to lighten tones and create highlights, essential for the 'gradation of light' described in color theory (Source 1).

composition

The composition should reflect a 'well-organized and balanced structure' (Source 5). De Smet’s work during this period moved away from the 'visual imitation of nature' toward 'pure expression' (Source 5). The arrangement of elements should prioritize structural balance and synthesis, influenced by Cubist elements (Source 6), rather than strict topographical accuracy. The sky is likely included as a significant element, consistent with landscape traditions where weather and sky are important compositional components (Source 2).

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

  1. step 01

    Sketch the basic forms of the haystacks and landscape using simplified lines and shapes. Focus on the mass and volume rather than fine details.

    Tip — Ensure the composition has a balanced structure, avoiding overly detailed rendering at this stage.

    Contour Drawing

underpainting

  1. step 02

    Apply a monochrome underpainting (grisaille) to establish the chiaroscuro effects and tonal values. This helps in perceiving the modifications of light on the model.

    Tip — Pay attention to the 'gradation of light' where juxtaposed tones affect each other (Source 1).

    Grisaille

first pass

  1. step 03

    Begin applying color using warm autumnal tones and blacks. Use broad brushstrokes to create solid masses of paint, reflecting de Smet’s stylistic shift.

    Tip — Avoid mixing colors too much on the palette; allow the 'simultaneous contrast' of juxtaposed colors to create vibrancy (Source 3).

    Impasto/Broad Brushwork

refining

  1. step 04

    Refine the composition by adjusting the balance and structure. Introduce glazing or scumbling techniques if needed to harmonize colors, particularly for sky or atmospheric effects.

    Tip — Be aware of 'mixed contrast' where the eye’s tendency to see complementary colors can distort perception (Source 3).

    Glazing/Scumbling

finishing

  1. step 05

    Finalize the painting by ensuring the expressive quality is maintained. Check that the 'solid masses of paint' hold their form and that the chiaroscuro effects are effective.

    Tip — Ensure the work does not revert to 'visual imitation of nature' but retains its expressive, structural integrity.

    Final Assessment

critical techniques

Simultaneous Contrast

Understanding that juxtaposed colors affect each other’s appearance, allowing the artist to create 'true gradation of light' and harmonize colors inherent to the object (Source 1, Source 3).

Chiaroscuro

Used to create depth and expressive quality, with de Smet employing it alongside simplified lines and shapes during his expressionist phase (Source 5).

Glazing and Scumbling

Techniques for layering color to achieve transparency and harmony, as described in historical oil painting practices (Source 4).

common pitfalls

  • →Over-rendering details: De Smet’s style during this period emphasized 'simplified lines and shapes' and 'solid masses of paint' rather than fine detail (Source 5).
  • →Ignoring color contrast: Failing to account for 'simultaneous contrast' can lead to muddy colors and a lack of vibrancy (Source 3).
  • →Reverting to realism: The artist explicitly moved away from 'visual imitation of nature' toward 'pure expression' (Source 5). Avoid overly realistic rendering.
  • →Eye fatigue: Prolonged focus on one color can lead to 'mixed contrast' errors, where the eye perceives complementary colors inaccurately (Source 3).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific visual details of the 1914 *Haystacks* painting (e.g., exact number of haystacks, specific background elements) are not described in the sources.
  • ·De Smet’s exact pigment choices for this specific work are not listed, only general palette shifts to 'warm autumnal tones' and 'blacks'.
  • ·The specific underpainting method used for this particular canvas is not documented, though general period techniques are available.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • Laws of Contrast of Colour↗

    • 6. Put beside each other two flat tints... — applied to Understanding simultaneous contrast and gradation of light in color application.
    • 315. As to the advantages the painter will find in it... — applied to Perceiving modifications of light and harmonizing colors.
  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Techniques of glazing, scumbling, and monochrome underpainting.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia bio — Gustave de Smet — part 2↗

    • Biography — applied to Stylistic shift to expressionism, use of chiaroscuro, simplified shapes, and warm autumnal palette.
  • Wikipedia bio — Gustave de Smet — part 1↗

    • Biography — applied to Context of exile, influence of Bergen School and Cubism on structure and balance.
  • Wikipedia: Landscape painting↗

    • Landscape painting — part 1 — applied to General role of sky and weather in landscape composition.
  • Wikipedia: Contour drawing↗

    • Contour drawing — part 1 — applied to Underdrawing approach focusing on mass and volume.

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann