apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Green autumn
Green autumn by Zinaida Serebriakova

plate no. 4275

Green autumn

Zinaida Serebriakova, 1908

oilImpressionismlandscapefieldswindmillsskylandscapehillspath

recreation guide

Zinaida Serebriakova’s 'Green autumn' (1908) is a landscape executed in oil, reflecting the Impressionist style prevalent in her early career before the political upheavals of 1917 forced her to abandon oil painting for cheaper mediums like charcoal (Source 7). The work belongs to the genre of landscape painting, which traditionally depicts natural scenery such as trees and forests, often including the sky and weather as compositional elements (Source 5). As an Impressionist work from 1908, it likely employs techniques characteristic of the period, such as the manipulation of light and color to capture the transient effects of autumn foliage, though specific visual details of the composition are not described in the provided sources. The painting represents a period when Serebriakova was gaining recognition, shortly before her major success with 'At the Dressing-Table' in 1909 (Source 7).

estimated time

20-30 hours over 5-7 sessions, allowing for drying time between layers

materials

8 items

steps

6 in sequence

materials

itempurposemodern equivalent
Oil paints (artist grade)Primary medium for the painting—
Linseed oilMedium to thin paint and adjust drying time; essential for 'fat over lean' layering—
Mineral spirits or turpentineSolvent to thin paint for initial layers and clean brushes—
CanvasSupport surface—
CharcoalFor initial sketching of the subject onto the canvas—
PaintbrushesPrimary tool for transferring paint to the surface—
Palette knivesAlternative application method or for scraping off paint if corrections are needed while wet—
RagsFor wiping brushes or removing wet paint layers—

preparation

surface prep

The canvas should be primed to accept oil paint. While specific priming methods for Serebriakova are not detailed in the sources, traditional oil painting techniques involve preparing a stable surface to ensure the paint film remains strong and does not crack or peel (Source 1). The artist likely used a standard ground suitable for oil application.

underdrawing

Traditional oil painting techniques often begin with the artist sketching the subject onto the canvas with charcoal or thinned paint (Source 1). Serebriakova likely used charcoal to establish the composition of the landscape, allowing for corrections before applying paint, as charcoal offers little resistance to a brush and can be easily modified (Source 4).

underpainting

The artist may have employed a monochrome underpainting (grisaille) to establish values before applying color. This technique involves painting in neutral tones, mentally extracting red and yellow colors, and then glazing or scumbling these colors over the dry underpainting (Source 2). This method was practiced by old masters and can help achieve depth and luminosity in the final work.

color palette

Green

Various greens, likely mixed with earth tones

Depicting autumn foliage and landscape elements

Yellow

Yellow pigments

Autumn leaves and light effects; applied via glazing or scumbling over underpainting

Red

Red pigments

Autumn foliage accents; applied via glazing or scumbling

White

White pigment

Highlights and mixing to adjust value

Raw Umber

Raw umber

Underpainting or initial tonal studies, as suggested for painting from life (Source 4)

composition

As a landscape painting, the work likely includes natural scenery such as trees and forests, with the sky and weather playing a role in the composition (Source 5). Specific compositional details are not provided in the sources, but the artist’s general practice involved careful observation of nature, potentially using mirrors to check proportions and perspectives (Source 4).

step by step

underdrawing→underpainting→first pass→refining→finishing→varnishing

underdrawing

  1. step 01

    Sketch the landscape composition onto the canvas using charcoal.

    Tip — Make all corrections at this stage to avoid fatal errors in paint application.

    Charcoal sketching

underpainting

  1. step 02

    Apply a monochrome underpainting (grisaille) using raw umber and white, thinned with turpentine, to establish values.

    Tip — Ensure this layer is completely dry before proceeding to color application.

    Grisaille

first pass

  1. step 03

    Begin applying color using glazing and scumbling techniques. Glaze transparent coats of yellow and red tones over the dry underpainting.

    Tip — Use oil as a medium initially; ensure each layer contains more oil than the previous one ('fat over lean').

    Glazing

refining

  1. step 04

    Scumble semi-opaque paint over darker areas to create coldness or grey blooms, allowing the underlying painting to show through.

    Tip — This technique helps in achieving the desired atmospheric effects in the landscape.

    Scumbling

finishing

  1. step 05

    Adjust colors, textures, and forms as needed. Oil paint remains wet longer, allowing for changes.

    Tip — If major corrections are needed while wet, use a rag and turpentine; if dry, scrape off with a palette knife.

    Wet-on-wet adjustment

varnishing

  1. step 06

    Allow the painting to dry completely (up to two weeks) before applying varnish if desired.

    Tip — Do not varnish until the paint is fully dry to the touch.

    Drying by oxidation

critical techniques

Fat over lean

Each additional layer of paint should contain more oil than the layer below to prevent cracking and peeling.

Glazing

Applying transparent coats of color over a dry underpainting to build up luminosity and depth.

Scumbling

Applying semi-opaque paint over a darker ground to create atmospheric effects and allow the underlying layer to show through.

Charcoal underdrawing

Using charcoal for initial sketches to allow for easy corrections before paint application.

common pitfalls

  • →Applying lean layers over fat layers, which can cause the painting to crack and peel (Source 1).
  • →Making corrections in paint after the underdrawing is complete, which can lead to a lack of lucidity (Source 4).
  • →Varnishing before the paint is fully dry, which can trap solvents and cause damage (Source 1).
  • →Ignoring the 'fat over lean' rule, leading to an unstable paint film (Source 1).

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific visual details of 'Green autumn' (e.g., exact composition, specific colors used) are not described in the sources.
  • ·Serebriakova's specific palette preferences for this particular painting are not detailed.
  • ·The exact ground preparation method used by Serebriakova is not specified.
  • ·Whether Serebriakova used glazing and scumbling in this specific work is inferred from general techniques of the period and old masters, not explicitly stated for this painting.

grounded in

The technical procedure in this guide traces to the following classical art-instruction texts.

  • The Practice of Oil Painting↗

    • COLOURING A MONOCHROME — applied to Glazing and scumbling techniques, grisaille underpainting.
    • PAINTING FROM LIFE — applied to Charcoal underdrawing, correction strategies, and initial palette setup.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Oil painting↗

    • Oil painting — part 2 — applied to General oil painting techniques, fat over lean rule, drying time, and tools.
  • Wikipedia: Landscape painting↗

    • Landscape painting — part 1 — applied to Definition and elements of landscape painting.
  • Wikipedia bio — Zinaida Serebriakova↗

    • Zinaida Serebriakova — part 2 — applied to Artist's biography, timeline, and shift from oil to charcoal due to economic hardship.

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann