plate no. 1361

Fields around the Forest

oil, canvasImpressionismlandscapetreeslandscapeskyfieldfigureroad

what to study here

It shows how broken, adjacent warm and cool strokes build sunlight and depth, with brushwork that changes by area.

The useful lesson here is how warm and cool color carry light and space without blending. The sunlit tree on the right is built from yellow-ochre dabs set directly beside blue and purple strokes, so the foliage vibrates instead of reading as one smooth mass. Study how the cool purple-blue shadows under the canopies give the warm leaves something to glow against. Then check the value structure with a squint: bright sky, dark tree shadows, and a warm middle ground make three clear zones. The pale path is the lightest accent in the lower half and carries the eye back past the trees to the field, figures, and buildings, which are kept small and simple. Notice the change in handling: the sky is softer with gentler transitions, the foliage is choppy and follows its forms, and the path and foreground get more deliberate directional marks. Edges are mostly soft and broken, with definition only where a form needs it. Copy the mark-making by area, not one stroke style across the whole canvas.

key decision

Sisley set warm yellow-ochre foliage strokes directly beside cool blue and purple shadow strokes instead of blending them. This produces the vibration of light and keeps the sunlit tree forward of the darker left mass.

recreation guide

Alfred Sisley’s 'Fields around the Forest' (1895) is a quintessential example of late Impressionist landscape painting, characterized by an emphasis on atmospheric light and naturalistic color over rigid outline. Sisley, who remained steadfastly committed to painting en plein air, typically focused on the transient effects of weather and light in rural settings. This work likely reflects his mature style, where the distinction between sky, field, and forest is mediated by a unified tonal harmony rather than sharp contours. The painting demonstrates the Impressionist goal of capturing the 'impression' of a scene through broken brushwork and optical color mixing, rather than detailed finish.

estimated time

20-30 hours over 5-7 sessions

materials

7 items

steps

5 in sequence

materials

item	purpose	modern equivalent
Oil paints (pre-mixed in tubes)	Primary medium for color application	—
Linseed oil	Medium to mix with pigments for consistency and drying time	—
Canvas	Support surface	—
Hog bristle brushes	For bolder strokes and impasto textures, suitable for landscape masses	—
Sable or synthetic brushes (round/flat)	For finer details and smoother blending in sky or distant foliage	—
Palette knife	For mixing paints and potentially applying thick layers or removing paint	—
Wooden palette	For holding and mixing small quantities of paint during the process	—

preparation

surface prep

The canvas should be primed with a traditional ground, likely white or off-white, to allow for the luminous quality characteristic of Impressionist work. While specific preparation for this exact canvas is not detailed in the sources, Sisley’s practice involved painting directly on prepared canvases, often outdoors. The surface should be smooth enough to allow for fine brushwork but textured enough to hold impasto if desired.

underdrawing

Sisley’s preparatory methods are not explicitly detailed in the provided sources. However, general oil painting practice suggests a light sketch may be made in charcoal or thinned paint to establish the horizon line and major masses of the forest and fields. Impressionists often worked quickly from life, so the underdrawing would be minimal and likely obscured by the first layer of paint.

underpainting

An underpainting (imprimatura) may be applied to establish the overall tonal values and color temperature of the scene. This could be a thin wash of a neutral gray or a warm earth tone, depending on the time of day depicted. This step helps in judging subsequent color mixtures against a non-white background, which is crucial for achieving the atmospheric depth seen in Sisley’s landscapes.

color palette

Sky Blue

Cobalt blue mixed with white and possibly a touch of yellow to correct hue shift

General use in this artist's palette for sky and light reflections

Foliage Green

Yellow ochre, viridian, and potentially a complementary red/purple to neutralize and darken without shifting hue toward blue

Forest and field vegetation

Earth Brown

Burnt sienna, umber, and white for tints

Paths, distant fields, and shadowed areas

White

Titanium or Zinc white

Lightening colors (tints) and highlights, used cautiously to avoid hue shifts

composition

Sisley characteristically composed landscapes with a focus on the interplay between sky and land, often giving significant space to the sky to convey weather and light. The composition likely features a horizontal division between the forest line and the fields, with the sky occupying a substantial portion of the canvas. This approach aligns with the Impressionist interest in atmospheric perspective and the unity of the scene through light.

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

step 01
Lightly sketch the horizon line and the major shapes of the forest and fields using charcoal or thinned paint.
Tip — Keep lines loose and minimal; they will be covered by paint.
Preparatory sketch

underpainting

step 02
Apply a thin wash of neutral color to establish the overall tone and value structure of the painting.
Tip — Ensure the wash is thin enough to remain transparent.
Imprimatura

first pass

step 03
Block in the large masses of color for the sky, fields, and forest using broad brushstrokes. Mix colors on the palette, adjusting lightness with white or complements as needed.
Tip — Avoid over-mixing; keep colors distinct to allow for optical blending.
Alla prima or layered approach

refining

step 04
Refine the edges and details, particularly in the foliage and sky. Use smaller brushes for finer details and adjust color mixtures to correct hue shifts caused by adding white or black.
Tip — If lightening a red or orange with white causes a blue shift, add a small amount of adjacent color (e.g., orange) to correct it.
Color correction

finishing

step 05
Add final highlights and shadows, ensuring the atmospheric perspective is consistent. Use impasto sparingly for emphasis if desired.
Tip — Check the painting from a distance to assess the overall harmony and light effects.
Impasto

critical techniques

Color Mixing and Hue Correction

When mixing pigments, colors become darker and lower in chroma. To lighten a color without shifting hue (e.g., reds shifting blue when mixed with white), add a small amount of an adjacent color. To darken without shifting hue, use the complementary color rather than black.

Brush Selection

Use hog bristle brushes for bold strokes and impasto in the foreground or textured areas. Use sable or synthetic brushes for finer details and smoother blending in the sky or distant elements.

Palette Knife Usage

A palette knife can be used to mix paints on the palette and to apply or remove paint from the canvas, offering control over texture and thickness.

common pitfalls

→Adding black to darken colors can cause hue shifts, particularly in yellows, oranges, and reds, moving them toward green or blue. Use complementary colors instead for neutralization.
→Adding white to reds and oranges can cause a shift toward blue. Correct this by adding a small amount of an adjacent color.
→Over-mixing paints on the palette can result in muddy, low-chroma colors. Mix small quantities as needed during the painting process.
→Using floppy brushes with no 'snap' (like squirrel hair) can make it difficult to maintain precise brushstrokes and detail.

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

·Specific pigments used by Sisley in 1895 are not detailed in the sources, though general 19th-century practices are noted.
·The exact composition and visual details of 'Fields around the Forest' are not described in the sources, so the guide relies on general Impressionist and Sisleyan characteristics.
·Sisley’s specific underdrawing and underpainting techniques for this work are not documented in the provided passages.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

Wikipedia: Color theory↗
- Color theory — part 6 — applied to Color mixing, hue correction, and lightness adjustment
Wikipedia: Oil painting↗
- Oil painting — part 6 — applied to Materials, brush types, and application techniques
Wikipedia bio — Alfred Sisley↗
- Alfred Sisley — part 4 — applied to Artist’s general practice and landscape focus

Read more about the corpus on the sources page and how the guides are built on the methods page.

read from the painting

observed from the image, not the label

6 dominant colors, measured

what the eye sees

Bright sunlight floods through a landscape framed by two massive trees—a golden, warmly lit tree dominates the right and center, while a darker, cooler tree mass anchors the left. The luminous blue sky occupies the upper third, creating a powerful atmospheric backdrop. A pale path curves through the foreground and recedes toward a field dotted with figures and rural buildings in the middle distance, drawing the eye through the composition with clear spatial progression.

value structure

The sky is the lightest value and most luminous element. The foliage masses create strong dark passages—particularly the deep purples and blues in shadow areas beneath the canopies. The lit portions of the right-side tree glow with warm mid-tones. The field and path occupy intermediate values, with the pale path providing a distinct light accent against warmer ochre and mauve field tones. Squint and you see three clear zones: bright sky, dark tree shadows, and warm middle ground.

observed palette and mixes

#9ea7bf
ultramarine blue + white + touch of cerulean
luminous sky filling the upper portion
#f4d48f
yellow ochre + cadmium yellow + touches of alizarin for warmth
sun-lit foliage on the prominent right tree
#5b4f3d
burnt sienna + ultramarine + cadmium red
tree trunks and darkest shadow accents
#6d5a7f
ultramarine + alizarin + white
cool purple shadows beneath tree canopies
#d4a574
raw sienna + yellow ochre + white
warm field and foreground earth tones
#e8dcc8
titanium white + touch of yellow ochre + ultramarine
pale path and light accents

edges and brushwork

Sisley's brushwork here is distinctly impressionistic—visible, choppy strokes that follow the form of the foliage. The tree masses are built with dabs and dashes of contrasting colors laid directly beside one another rather than blended smooth; warm yellows sit adjacent to cool blues and purples to create vibration and light. The sky is more softly handled with gentler transitions, while the path and foreground receive more deliberate, directional marks. Edges are generally soft and broken except where a distinct form needs definition.

a working sequence

01
Block the sky and establish proportions
Cover the upper two-thirds with the luminous blue sky using broad, soft strokes. Lightly indicate the horizon line and sketch the silhouettes of the two main tree masses—one large tree framing the right side, one creating a softer mass on the left. The sky should feel open and airy; don't leave canvas gaps.
02
Mass in the dark foliage shadows
Block in the deepest shadow areas beneath the tree canopies using dark purple-blues (ultramarine + alizarin + white). These dark passages anchor the composition and establish the strongest value contrasts. Focus on the shadow edges of both trees and the darker left-side foliage mass.
03
Layer the lit tree foliage with warm yellows
Build the prominent right-side tree with warm yellow-ochre tones, using visible, directional brushstrokes. Layer cadmium yellows and ochres over the sky, then adjust with greens and warm darks to show depth. Leave some of the underlying blue-shadow layer visible between strokes for luminosity. This tree should feel sun-drenched and advance toward the viewer.
04
Develop cooler greens and foliage texture on the left
Address the left-side tree and background foliage with cooler, more muted greens mixed from yellow ochre, ultramarine, and touches of alizarin. Use the same choppy brushwork but with slightly more subdued color. Layer purples and dark blues into shadow areas to show form and depth without overblending.
05
Paint the middle ground and focal elements
Block in the warm, mauve-tinted field and the pale path that recedes into the distance. Indicate the distant buildings, haystacks, and figures with small, simplified shapes—they should read from distance, not be detailed. The path is crucial for spatial recession; keep it warm ochre where shadowed, pale where lit, and ensure it clearly recedes between the tree masses.
06
Strengthen edges and foliage definition
Refine the edges of the prominent trees by adding crisp contours where branches reach into the sky. Add final touches of bright yellow-ochre highlights to the sunlit portions of foliage. Sharpen the silhouette of the right tree against the sky. Keep the distant tree line soft and cool to reinforce atmospheric perspective.
07
Final adjustments and atmospheric unity
Check that the sky remains the brightest, most luminous value—not dirty or too dark. Verify that warm and cool colors create a clear temperature gradient: cool shadows (blue-purple) contrasting with warm sun-struck areas (yellow-orange). Add any final accent marks to the foreground path or field to tie the composition together. Step back and assess the overall rhythm of warm and cool passages.

where studies of this painting go wrong

Overblending the foliage: the impressionist texture depends on visible brushstrokes and color juxtaposition, not smooth transitions
Neglecting the warm-cool temperature shifts: lit areas should glow with yellow-ochre warmth while shadows contain violet and blue undertones
Losing the path as a compositional anchor: it guides spatial recession and must remain distinct and pale enough to read through the composition
Making the sky too pale or washed out: it's luminous but should retain saturation and hold its blue tone against the foliage masses

measured difficulty