apprentice
artistsserieslearnchatartworkscommunity galleryblog
apprentice

deliberate practice for serious artists

writingsourcesmethodsaboutgalleryprivacyterms
built by reducibl.com
home·artworks·Fields around the Forest
Fields around the Forest by Alfred Sisley

plate no. 1361

Fields around the Forest

Alfred Sisley, 1895

oil, canvasImpressionismlandscapetreeslandscapeskyfieldfigureroad

recreation guide

Alfred Sisley’s 'Fields around the Forest' (1895) is a quintessential example of late Impressionist landscape painting, characterized by an emphasis on atmospheric light and naturalistic color over rigid outline. Sisley, who remained steadfastly committed to painting en plein air, typically focused on the transient effects of weather and light in rural settings. This work likely reflects his mature style, where the distinction between sky, field, and forest is mediated by a unified tonal harmony rather than sharp contours. The painting demonstrates the Impressionist goal of capturing the 'impression' of a scene through broken brushwork and optical color mixing, rather than detailed finish.

estimated time

20-30 hours over 5-7 sessions

materials

7 items

steps

5 in sequence

materials

itempurposemodern equivalent
Oil paints (pre-mixed in tubes)Primary medium for color application—
Linseed oilMedium to mix with pigments for consistency and drying time—
CanvasSupport surface—
Hog bristle brushesFor bolder strokes and impasto textures, suitable for landscape masses—
Sable or synthetic brushes (round/flat)For finer details and smoother blending in sky or distant foliage—
Palette knifeFor mixing paints and potentially applying thick layers or removing paint—
Wooden paletteFor holding and mixing small quantities of paint during the process—

preparation

surface prep

The canvas should be primed with a traditional ground, likely white or off-white, to allow for the luminous quality characteristic of Impressionist work. While specific preparation for this exact canvas is not detailed in the sources, Sisley’s practice involved painting directly on prepared canvases, often outdoors. The surface should be smooth enough to allow for fine brushwork but textured enough to hold impasto if desired.

underdrawing

Sisley’s preparatory methods are not explicitly detailed in the provided sources. However, general oil painting practice suggests a light sketch may be made in charcoal or thinned paint to establish the horizon line and major masses of the forest and fields. Impressionists often worked quickly from life, so the underdrawing would be minimal and likely obscured by the first layer of paint.

underpainting

An underpainting (imprimatura) may be applied to establish the overall tonal values and color temperature of the scene. This could be a thin wash of a neutral gray or a warm earth tone, depending on the time of day depicted. This step helps in judging subsequent color mixtures against a non-white background, which is crucial for achieving the atmospheric depth seen in Sisley’s landscapes.

color palette

Sky Blue

Cobalt blue mixed with white and possibly a touch of yellow to correct hue shift

General use in this artist's palette for sky and light reflections

Foliage Green

Yellow ochre, viridian, and potentially a complementary red/purple to neutralize and darken without shifting hue toward blue

Forest and field vegetation

Earth Brown

Burnt sienna, umber, and white for tints

Paths, distant fields, and shadowed areas

White

Titanium or Zinc white

Lightening colors (tints) and highlights, used cautiously to avoid hue shifts

composition

Sisley characteristically composed landscapes with a focus on the interplay between sky and land, often giving significant space to the sky to convey weather and light. The composition likely features a horizontal division between the forest line and the fields, with the sky occupying a substantial portion of the canvas. This approach aligns with the Impressionist interest in atmospheric perspective and the unity of the scene through light.

step by step

underdrawing→underpainting→first pass→refining→finishing

underdrawing

  1. step 01

    Lightly sketch the horizon line and the major shapes of the forest and fields using charcoal or thinned paint.

    Tip — Keep lines loose and minimal; they will be covered by paint.

    Preparatory sketch

underpainting

  1. step 02

    Apply a thin wash of neutral color to establish the overall tone and value structure of the painting.

    Tip — Ensure the wash is thin enough to remain transparent.

    Imprimatura

first pass

  1. step 03

    Block in the large masses of color for the sky, fields, and forest using broad brushstrokes. Mix colors on the palette, adjusting lightness with white or complements as needed.

    Tip — Avoid over-mixing; keep colors distinct to allow for optical blending.

    Alla prima or layered approach

refining

  1. step 04

    Refine the edges and details, particularly in the foliage and sky. Use smaller brushes for finer details and adjust color mixtures to correct hue shifts caused by adding white or black.

    Tip — If lightening a red or orange with white causes a blue shift, add a small amount of adjacent color (e.g., orange) to correct it.

    Color correction

finishing

  1. step 05

    Add final highlights and shadows, ensuring the atmospheric perspective is consistent. Use impasto sparingly for emphasis if desired.

    Tip — Check the painting from a distance to assess the overall harmony and light effects.

    Impasto

critical techniques

Color Mixing and Hue Correction

When mixing pigments, colors become darker and lower in chroma. To lighten a color without shifting hue (e.g., reds shifting blue when mixed with white), add a small amount of an adjacent color. To darken without shifting hue, use the complementary color rather than black.

Brush Selection

Use hog bristle brushes for bold strokes and impasto in the foreground or textured areas. Use sable or synthetic brushes for finer details and smoother blending in the sky or distant elements.

Palette Knife Usage

A palette knife can be used to mix paints on the palette and to apply or remove paint from the canvas, offering control over texture and thickness.

common pitfalls

  • →Adding black to darken colors can cause hue shifts, particularly in yellows, oranges, and reds, moving them toward green or blue. Use complementary colors instead for neutralization.
  • →Adding white to reds and oranges can cause a shift toward blue. Correct this by adding a small amount of an adjacent color.
  • →Over-mixing paints on the palette can result in muddy, low-chroma colors. Mix small quantities as needed during the painting process.
  • →Using floppy brushes with no 'snap' (like squirrel hair) can make it difficult to maintain precise brushstrokes and detail.

what the sources don't tell us

Where the corpus is silent, we say so rather than guess. These are the gaps a complete recreation guide would normally cover that our source passages don't.

  • ·Specific pigments used by Sisley in 1895 are not detailed in the sources, though general 19th-century practices are noted.
  • ·The exact composition and visual details of 'Fields around the Forest' are not described in the sources, so the guide relies on general Impressionist and Sisleyan characteristics.
  • ·Sisley’s specific underdrawing and underpainting techniques for this work are not documented in the provided passages.

cross-referenced from

Named facts about this artwork and artist were checked against these reference pages.

  • Wikipedia: Color theory↗

    • Color theory — part 6 — applied to Color mixing, hue correction, and lightness adjustment
  • Wikipedia: Oil painting↗

    • Oil painting — part 6 — applied to Materials, brush types, and application techniques
  • Wikipedia bio — Alfred Sisley↗

    • Alfred Sisley — part 4 — applied to Artist’s general practice and landscape focus

Read more about the corpus on the sources page and how the guides are built on the methods page.

tips & new artworks in your inbox

no spam — unsubscribe anytime.

or to save artworks, chat, and track progress

related guides

oil painting for beginners →color theory for painters →how to learn by studying the masters →
chat about this artwork

in this vein

related artworks

View of the Bosphorus and Rumeli Hisarı

View of the Bosphorus and Rumeli Hisarı

Sevket Dag

Paysage du Midi

Paysage du Midi

Armand Guillaumin

Self-Portrait

Self-Portrait

Frederic Bazille

Tip of the Bay

Tip of the Bay

Max Kurzweil

Long Stemmed Lovelies

Long Stemmed Lovelies

Pino Daeni

At Rosetta, Lower Egypt

At Rosetta, Lower Egypt

John Varley II

House from Oltenia

House from Oltenia

Theodor Pallady

Jewish quarter in Amsterdam

Jewish quarter in Amsterdam

Max Liebermann